DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nkx6.1 and B-H2

DIOPT Version :10

Sequence 1:NP_001002475.1 Gene:nkx6.1 / 436748 ZFINID:ZDB-GENE-040718-178 Length:312 Species:Danio rerio
Sequence 2:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster


Alignment Length:70 Identity:31/70 - (44%)
Similarity:47/70 - (67%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


Zfish   177 SVLLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKW 241
            |:.|.|  |::..|..|:..|:..|||:||:.|||:..:|..||..|.:::.|||.|:|||||||
  Fly   373 SLSLSK--KQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKW 435

Zfish   242 RKRHA 246
            :::.|
  Fly   436 KRQTA 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nkx6.1NP_001002475.1 Homeodomain 185..243 CDD:459649 27/57 (47%)
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 26/55 (47%)

Return to query results.
Submit another query.