DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and TTBK1

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_016866853.1 Gene:TTBK1 / 84630 HGNCID:19140 Length:1409 Species:Homo sapiens


Alignment Length:359 Identity:118/359 - (32%)
Similarity:171/359 - (47%) Gaps:64/359 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VGNKYRLGRKIGSGSFGDIYLGTTINTGEEVAIKLECIRTKHPQLHIESKFYKTMQGGIGIPRII 69
            |.:::::.:|||.|.||:||....:.|.|.||:|:|..:.....|.:|....|.:||...:.|.|
Human    30 VKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFI 94

  Fly    70 WCGSEGDYNVMVMELLGPSLEDLFNFCSRR------FSLKTVLLLADQMISRIDYIHSRDFIHRD 128
            .||....:|.:||:|.|.:|.||     ||      |:|.|.|.|..|::..|:.|||..|:|||
Human    95 GCGRNEKFNYVVMQLQGRNLADL-----RRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRD 154

  Fly   129 IKPDNFLMG-LGKKGNLVYIIDFGLAKKFR----DARSLKHIPYRENKNLTGTARYASINTHLGI 188
            |||.||.|| |.......|::|||||:::.    |.|     |.|......||.||||:|.|...
Human   155 IKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVR-----PPRNVAGFRGTVRYASVNAHKNR 214

  Fly   189 EQSRRDDLESLGYVLMYFNLGALPWQGLKAANK----RQKYERISEKKLSTSIVVLCKGFPSEFV 249
            |..|.|||.||.|:|:.|.:|.|||:.:|...:    ::|||.          .:|.|..||||.
Human   215 EMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEH----------RMLLKHMPSEFH 269

  Fly   250 NYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNLLKFGGPRNPQAIQQAQDGADGQ 314
            .:|:....:.:..:|||..:..:|.|.....|...:..|||.                      :
Human   270 LFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWE----------------------K 312

  Fly   315 AGHDAVAAAAAVAAAAAASSHQQQQHKVNAALGG 348
            ||.||:       .:.:.|:..||..:..||:.|
Human   313 AGTDAL-------LSTSTSTPPQQNTRQTAAMFG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 103/288 (36%)
TTBK1XP_016866853.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.