DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and Vrk2

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_081536.2 Gene:Vrk2 / 69922 MGIID:1917172 Length:503 Species:Mus musculus


Alignment Length:298 Identity:99/298 - (33%)
Similarity:146/298 - (48%) Gaps:42/298 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GNKYRLGRKIGSGSFGDIYLGTTINTGEEVA---IKLECIRTKHPQLHIESKFY----------K 57
            ||::.||:.||||.||.|||....|...:.|   ||||  ..::..|..|.|||          |
Mouse    26 GNRWALGKMIGSGGFGLIYLAFPTNKPNKDARHVIKLE--YQENGPLFSELKFYQRAAKRECIQK 88

  Fly    58 TMQ----GGIGIPRIIWCG----SEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMIS 114
            .:|    ..:|||.....|    ....|..||||.||..|:.|.: .:..|...|||.|..:|:.
Mouse    89 WIQQRKLDYLGIPVFYGFGLTDFKGRSYRFMVMERLGIDLQKLLD-QNGGFKKLTVLQLGIRMLD 152

  Fly   115 RIDYIHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYREN--KNLTGTA 177
            .::|||..:::|.|||..|.|:.. ...:.||:.|:||:  :|...:..|..|:|:  |...||.
Mouse   153 VLEYIHENEYVHGDIKAANLLLDF-TNPDRVYLADYGLS--YRYCPNGNHKQYQEDPRKGHNGTI 214

  Fly   178 RYASINTHLGIEQSRRDDLESLGYVLMYFNLGALPWQGL---KAANKRQKYERISEKKLSTSIVV 239
            .:.|::.|.|:..|||.|:|.|||.::::..|.|||:..   ..|.:..|...:.|  |..|:: 
Mouse   215 EFTSLDAHKGVAPSRRSDVEILGYCMLHWLFGKLPWEAKLDDPVAVQTAKTNLLDE--LPESVL- 276

  Fly   240 LCKGFP-----SEFVNYLNFCRQMHFDQRPDYCHLRKL 272
              |..|     ||.|.||.:...:.:|.:|||..|:|:
Mouse   277 --KWAPSGSSCSELVKYLMYVHNLAYDDKPDYQKLKKI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 97/296 (33%)
Vrk2NP_081536.2 PKc_like 16..314 CDD:389743 99/298 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..395
Interaction with MAP3K7. /evidence=ECO:0000250 392..503
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.