DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and vrk3

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001013586.1 Gene:vrk3 / 541443 ZFINID:ZDB-GENE-030131-246 Length:459 Species:Danio rerio


Alignment Length:226 Identity:61/226 - (26%)
Similarity:105/226 - (46%) Gaps:12/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IGIPRIIWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMISRIDYIHSRDFIHR 127
            :|||..:..|....|..:|...:|..|:...:..:...|.|.||.||.:::..:::||.:::.|.
Zfish   235 LGIPSCVGFGLHETYRFLVFPCMGQPLQTELDEGTGSLSEKNVLQLALRLLDSLEFIHEKEYAHA 299

  Fly   128 DIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYRENKNLT--GTARYASINTHLGIEQ 190
            ||...|..: .......|::..||.|  ||.....||:.||:.....  |...:.|:::|.|...
Zfish   300 DIHAGNIYI-KSSSHTEVFLSGFGHA--FRFCPGGKHVEYRQGSRTAHQGNISFISLDSHKGAGP 361

  Fly   191 SRRDDLESLGYVLMYFNLGALPWQGLKAANKRQKYERISEKKLS--TSIVVLC---KGFPSEFVN 250
            |||.||:||||.::.:..|:|||..|...:.....|:  |:.:|  ..::..|   |...|....
Zfish   362 SRRSDLQSLGYCMLCWMTGSLPWSHLSHNSSSVAAEK--ERYMSDVPGLLTYCYKQKKASSALQE 424

  Fly   251 YLNFCRQMHFDQRPDYCHLRKLFRNLFHRLG 281
            ||.....:.:.::|||..|:...:....::|
Zfish   425 YLCNVMALQYTEKPDYTLLKGGLQQSLQKMG 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 61/226 (27%)
vrk3NP_001013586.1 DUF4758 <9..>104 CDD:292572
PK_VRK3 154..451 CDD:271026 60/220 (27%)
SPS1 236..>384 CDD:223589 45/150 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.