DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and ball

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster


Alignment Length:297 Identity:96/297 - (32%)
Similarity:139/297 - (46%) Gaps:31/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KYRLGRKIGSGSFGDIYLGTTINTGEEVAIKLECIRTKHPQLHIESKFY----------KTMQ-- 60
            ::|:|..||.|.||:||....:......|: ::|....:..|.:|..||          :.||  
  Fly    46 QWRIGPSIGVGGFGEIYAACKVGEKNYDAV-VKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKH 109

  Fly    61 --GGIGIPRIIWCGS---EGD-YNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMISRIDYI 119
              ..:|:|.|:..||   .|: :..:||...|..|........:|....||..||.||:....|:
  Fly   110 GLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVYQYM 174

  Fly   120 HSRDFIHRDIKPDNFLMGLGKKGNL-VYIIDFGLAKKFRDARSLKHIPYRENKNLTGTARYASIN 183
            ||..::|.|:|..|.|:||.|.|.. .|::|||||..|... ..|..|   .|...||..|.|.:
  Fly   175 HSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFVTG-DFKPDP---KKMHNGTIEYTSRD 235

  Fly   184 THLGIEQSRRDDLESLGYVLMYFNLGA-LPW--QGLKAA-NKRQKYERISEKKLSTSIVVLC-KG 243
            .|||: .:||.|||.|||.|:.: ||| |||  |.|.|. .|.||.:......:..|:..|. ||
  Fly   236 AHLGV-PTRRADLEILGYNLIEW-LGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKG 298

  Fly   244 FPSEFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRL 280
            .|....:::.:..::..:|.|||...|..|.:...:|
  Fly   299 VPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 96/297 (32%)
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 94/288 (33%)
SPS1 47..432 CDD:223589 96/296 (32%)
Pol_alpha_B_N <399..>502 CDD:285602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.