DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and CG8878

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster


Alignment Length:550 Identity:99/550 - (18%)
Similarity:154/550 - (28%) Gaps:287/550 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YRLGRKIGSGSFGDIYLG---TTINTGEEVA---------------IKLEC-IRTKH-------- 46
            :||||.||.|:||:|:|.   |......|.|               :::.| |.|..        
  Fly   123 WRLGRPIGKGNFGEIFLASDDTVCPASSETAKYVVKIEPHSNGPLFVEIHCLINTSRNNDLSDAA 187

  Fly    47 --------PQLHIESKFYKTMQGGIGIPRIIWCGSE--GD--YNVMVMELLGPSLEDLFNFCSRR 99
                    ||.|:.|:...:     |||..|..|:.  ||  |..:|:......|..|..  :.|
  Fly   188 EDAASLPAPQTHVLSRGPPS-----GIPSFIASGTHYFGDVRYRFLVLPRFDRDLHSLIK--NSR 245

  Fly   100 FSLKTVLLLADQMISRIDYIHSRDFIHRDIKPDNFLMGLGK--------KGN------------- 143
            ...|::|:||..:|:.::.:|.:.:.|.|||..|.::...|        |||             
  Fly   246 VQQKSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMVSKCKYLRRQVVPKGNGYEDHYEEKQQTT 310

  Fly   144 ----------------------------------------------------------------- 143
                                                                             
  Fly   311 DSGNSSEQETNDDDYFLKSEKFALKKIVDIKQDEDEDDEDFDDGATSNSNNSNSLDVFHTPVNKK 375

  Fly   144 ----------------------------------------------------------------- 143
                                                                             
  Fly   376 RSARNAIQFSGSNPVRACRREKRNSMYEEMVKSHYLRPTKRISYREEFNEDGYPKETAENSDESP 440

  Fly   144 ----------------------------------------------------------------- 143
                                                                             
  Fly   441 ESSDNESDEFIPPSSRRSVIKRGRSAQIATPKKTPVSTRASRQEKVKKEPNGDQKLRSRGSKHLD 505

  Fly   144 --------------LVYIIDFGLAKKFRDARSLKHIPY--RENKNLTGTARYASINTHLGIEQSR 192
                          .|::||||||.||:| |.: |.|:  .:.:...||..:.|.:.||| ..||
  Fly   506 NNPTEYKFLPTEEEHVFLIDFGLASKFQD-RGV-HRPFIMDQRRAHDGTLEFTSRDAHLG-AHSR 567

  Fly   193 RDDLESLGYVLMYFNLGALPWQGLKAANKRQKYERISEKKLSTSIVVLCKGF-----PSEFVNYL 252
            |.|||.|||.|:|::.|.|||:.:....:::|..|..| ...|.:..:.:.|     |.....:|
  Fly   568 RSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKE-LFMTDVPEMLRQFYGKQVPKYLGEFL 631

  Fly   253 NFCRQMHFDQRPDYCHLRKLFRNLFHRLGF 282
            ....|:.:.:||:|...||:|:..:.|||:
  Fly   632 LQIGQLAYQERPNYERYRKIFKREYQRLGY 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 98/548 (18%)
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 44/169 (26%)
SPS1 123..>284 CDD:223589 44/167 (26%)
SPS1 <491..756 CDD:223589 51/174 (29%)
PKc_like <517..652 CDD:304357 47/138 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.