DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and Vrk1

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001012194.1 Gene:Vrk1 / 362779 RGDID:1306069 Length:414 Species:Rattus norvegicus


Alignment Length:336 Identity:100/336 - (29%)
Similarity:162/336 - (48%) Gaps:41/336 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KYRLGRKIGSGSFGDIYLGTTINTGEEVAIKLECIRTKHPQ----LHIESKFY------KTMQGG 62
            :::||..||.|.||.|||..| |:.:.|.....|:....|.    |..|.|||      :.:|..
  Rat    36 EWKLGLPIGQGGFGCIYLADT-NSSKPVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKW 99

  Fly    63 I--------GIPRIIWCGSEGD-----YNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMIS 114
            |        |:|: .|.....|     |..|:|:..|..|:.::...::|||.||||.|:.:::.
  Rat   100 IHTHKLKYLGVPK-YWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILD 163

  Fly   115 RIDYIHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYRENKNL--TGTA 177
            .::|||..:::|.|||..|.|:.. |..:.||::|:|||  :|......|..|:|:...  .||.
  Rat   164 ILEYIHEHEYVHGDIKASNLLLSY-KNPDQVYLVDYGLA--YRYCPDGVHKEYKEDPKRCHDGTL 225

  Fly   178 RYASINTHLGIEQSRRDDLESLGYVLMYFNLGALPWQ-GLKAANKRQKYERISEKKLSTSIVVL- 240
            .:.||:.|.|:..|||.|||.|||.::.:..|.|||: .||..|    |.|.|:.:...::..| 
  Rat   226 EFTSIDAHNGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPN----YVRQSKIRYRDNVAALM 286

  Fly   241 --C---KGFPSEFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNLLKFGGPRN 300
              |   :..|.|...|:...:.:.:.::|.|.:||.:.......:|...|...|::.::.|....
  Rat   287 EKCFPERNKPGEIAKYMETVKLLDYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVNT 351

  Fly   301 PQAIQQAQDGA 311
            ..|.::.:.||
  Rat   352 KPASKKRKKGA 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 93/305 (30%)
Vrk1NP_001012194.1 STKc_VRK1 26..326 CDD:271024 93/298 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.