DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and Vrk2

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_008768654.1 Gene:Vrk2 / 360991 RGDID:1311585 Length:503 Species:Rattus norvegicus


Alignment Length:298 Identity:93/298 - (31%)
Similarity:143/298 - (47%) Gaps:42/298 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GNKYRLGRKIGSGSFGDIYLGTTINTGEEVA---IKLECIRTKHPQLHIESKFYKTMQ------- 60
            ||::.||:.||||.||.|||....|..|:.|   ||:|  ..::..|..|.|||:...       
  Rat    26 GNQWALGKMIGSGGFGLIYLAFPTNKPEKDARHVIKVE--YQENGPLFSELKFYQRAAKRECIQK 88

  Fly    61 -------GGIGIPRIIWCG----SEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMIS 114
                   ..:|:|.....|    ....|..||||.||..|:.|.| .:..|...|||.|..:|:.
  Rat    89 WVKQRKLDYLGVPVFYGFGLTDFKGRSYRFMVMERLGIDLQKLLN-QNGAFKKLTVLQLGIRMLD 152

  Fly   115 RIDYIHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYREN--KNLTGTA 177
            .::|||..:::|.|||..|.|:|.... :.||:.|:||:  :|...:..|..|.|:  |...||.
  Rat   153 VLEYIHENEYVHGDIKAANLLLGYANP-DRVYLADYGLS--YRYCPNGNHKQYHEDPRKGHNGTL 214

  Fly   178 RYASINTHLGIEQSRRDDLESLGYVLMYFNLGALPWQ-------GLKAANKRQKYERISEKKLS- 234
            .:.|::.|.|:..|||.|:|.|||.::.:..|.|||:       .::.| |.:..:.:.|..|. 
  Rat   215 EFTSLDAHKGVAPSRRSDVEILGYCMLRWLCGKLPWETNLENPVAVQTA-KTKLLDELPESVLKW 278

  Fly   235 TSIVVLCKGFPSEFVNYLNFCRQMHFDQRPDYCHLRKL 272
            |:....|:    |...:..:...:.:|.:|||..|:|:
  Rat   279 TTSGSSCR----ELAEFFMYVHNLAYDAKPDYQKLKKI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 91/296 (31%)
Vrk2XP_008768654.1 PKc_like 16..314 CDD:304357 93/298 (31%)
Pkinase 29..290 CDD:278497 85/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.