DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and ZK666.8

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_496261.2 Gene:ZK666.8 / 191385 WormBaseID:WBGene00014048 Length:391 Species:Caenorhabditis elegans


Alignment Length:208 Identity:67/208 - (32%)
Similarity:111/208 - (53%) Gaps:6/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IGSGSFGDIYLGTTINTGEEVAIKLECIRTKHP---QLHIESKFYKTMQGGIGIPRIIWCGSEGD 76
            ||.|.:|:|||...:...||||||.|.:..|..   ::.:|......:||...:|.|...|...:
 Worm    99 IGKGGYGEIYLAIDMKLAEEVAIKAEPLVRKGKIARRMILEQAVLVKLQGKPHVPWIFGSGHTEN 163

  Fly    77 YNVMVMELLGPSLEDLFNFC-SRRFSLKTVLLLADQMISRIDYIHSRDFIHRDIKPDNFLMGL-G 139
            :|.:|::||..:|.|:.... :|:.|..:|..:|.|.|:.:..:|...::||||||.|...|: .
 Worm   164 FNFIVLQLLSANLGDIRRMSPTRKLSKSSVGRIAVQAIAALRDLHDVGYLHRDIKPGNMCFGITS 228

  Fly   140 KKGNLVYIIDFGLAKKFRDARSLKHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLM 204
            |..:::.::||||.::::|... :...:|......||.||.|...|..:||:..||:.||.|.|:
 Worm   229 KTRHVLMLLDFGLVRRYKDPDG-EWRTHRVKAGFRGTQRYVSTRVHRRLEQTPTDDMVSLLYTLI 292

  Fly   205 YFNLGALPWQGLK 217
            ....|.|||:.::
 Worm   293 ELLAGELPWRNIE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 67/208 (32%)
ZK666.8NP_496261.2 PKc_like 92..354 CDD:389743 67/208 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.