DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and ZK507.1

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_499015.2 Gene:ZK507.1 / 191336 WormBaseID:WBGene00013978 Length:331 Species:Caenorhabditis elegans


Alignment Length:214 Identity:67/214 - (31%)
Similarity:100/214 - (46%) Gaps:22/214 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EEVAIKLEC-IRTKH-PQLHIESKFYKT-----MQGGIGIPRIIWCGSEGDYNVMVMELLGPSLE 90
            :|.|:|.|. ..:|| .:|.||....::     .|.......:|..|....:..:||.::|||||
 Worm    13 KEYAMKTELKFASKHSSRLKIERNVMESYSKCDAQCKEHFSELIDFGQSPVWKWIVMTIVGPSLE 77

  Fly    91 DL-FNFCSRRFSLKTVLLLADQMISRIDYIHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAK 154
            :| ..:........|:|....|.:..|...|...|:||||||.|:.:|.|.|...:|::|||||:
 Worm    78 ELKMKYKPSDIPPSTILQCGLQTMKAIHDFHQIGFLHRDIKPANYCIGYGSKSETIYVLDFGLAR 142

  Fly   155 KFR----DARSLKHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNL---GALP 212
            |:|    ..|     |.|....:.||.||.|..:|...|..||||.||  :..|:.:|   ..:.
 Worm   143 KYRLPNGQVR-----PPRPKTKMIGTPRYCSRASHRCEELGRRDDYES--WFFMFIDLVDTTLID 200

  Fly   213 WQGLKAANKRQKYERISEK 231
            |:||...:...|.:.:..|
 Worm   201 WKGLTRPDAYAKKQELFTK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 67/214 (31%)
ZK507.1NP_499015.2 SPS1 9..>168 CDD:223589 51/159 (32%)
PKc_like 10..252 CDD:304357 67/214 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.