DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and F41G3.5

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_495378.2 Gene:F41G3.5 / 185631 WormBaseID:WBGene00018301 Length:331 Species:Caenorhabditis elegans


Alignment Length:302 Identity:95/302 - (31%)
Similarity:153/302 - (50%) Gaps:28/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MELRVGNK---YRLGRKIGSGSFGDIYLGTTINTGEEVAIKLECIRTKHPQLHIESKFYKTMQGG 62
            :||..|.:   |::.|.|..|:||.:|....||| ...|:|||...::...|.:|:...:::   
 Worm    17 VELDKGYRLLDYKVVRFIAKGAFGAVYQVDHINT-LPFALKLESRSSETRNLKMEAVVLRSL--- 77

  Fly    63 IGIP-------RIIWCGSEGDYNVMVMELLGPSLEDLFNFC-SRRFSLKTVLLLADQMISRIDYI 119
              :|       |:.:||....:|.::|.|:|.:|.:|...| :|:||.:|.|.:..|||:.|..:
 Worm    78 --LPIRSPYFCRVFFCGKAEKFNFLIMTLVGKNLSELRANCPNRKFSRRTGLQIGIQMINAIQQL 140

  Fly   120 HSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRD--ARSLKHIPYRENKNLTGTARYASI 182
            ||..||||||||.||.:.|.....|| ::|||:.:|:.:  ...|:| |........||.|||.:
 Worm   141 HSIGFIHRDIKPANFCINLDNPHQLV-MVDFGMCRKYLNDGGTQLRH-PRWSVHGFRGTVRYAPL 203

  Fly   183 NTHLGIEQSRRDDLESLGYVLMYFNLGALPWQGLKAANKRQKYERISEKKLSTSIVVLCKGFPSE 247
            .||.|.:..|::|||::.|||:...:|.|||..::   :....|...:...:|.:.....|.|.:
 Worm   204 ATHYGRDSCRKEDLETIFYVLVELLVGTLPWMTME---EHIHVEHSKQVARTTGLREFLSGCPKQ 265

  Fly   248 FVNYLNFCRQMHFDQRPDYCHLRKL----FRNLFHRLGFTYD 285
            .|:.|.:...:.|...|||..:|.|    ..|..|...|.::
 Worm   266 LVHILLYIDNLRFYDAPDYALIRGLLSFALENCQHNGSFEWE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 91/290 (31%)
F41G3.5NP_495378.2 PKc_like 28..292 CDD:389743 89/274 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.