DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and F26A1.4

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_497995.2 Gene:F26A1.4 / 184945 WormBaseID:WBGene00017803 Length:206 Species:Caenorhabditis elegans


Alignment Length:213 Identity:56/213 - (26%)
Similarity:88/213 - (41%) Gaps:28/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 QMISRIDYIHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYRENKNLTG 175
            |::..:..:|..:|:||||||.|..:| ......:|:||:.|.:::.|.......| |....|.|
 Worm     3 QVLKALALVHRAEFLHRDIKPPNCCIG-ATDCTRIYLIDYVLTRQYLDKCGTVRNP-RPGLGLRG 65

  Fly   176 TARYASINTHLGIEQSRRDDLESLGYVLMYFNLGALPWQGLKAANK--RQKYERISEKKLSTSIV 238
            |.||.|::.|...:...::||.|..|..:....|.|||...|:...  :.|...|.||       
 Worm    66 TMRYMSLDAHARQDLGPKNDLVSFLYTTIECGDGCLPWSYEKSEENCIKLKQAHIGEK------- 123

  Fly   239 VLCKGFP-----SEFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNLLKFGGP 298
             ||...|     :|::..||      :...|||..|..|.... :.........::|   ::..|
 Worm   124 -LCIKKPLMTKAAEYIESLN------YHSIPDYEKLLALIEEC-NPADLKESEPYEW---QYRQP 177

  Fly   299 RNPQAIQQAQDGADGQAG 316
            .||.. ....:|.:|..|
 Worm   178 HNPMT-PTTGEGLNGTPG 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 49/177 (28%)
F26A1.4NP_497995.2 PKc_like <3..157 CDD:389743 49/169 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.