DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and C55B7.10

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_491873.4 Gene:C55B7.10 / 183845 WormBaseID:WBGene00016946 Length:369 Species:Caenorhabditis elegans


Alignment Length:273 Identity:84/273 - (30%)
Similarity:136/273 - (49%) Gaps:14/273 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GNKYRLGRKIGSGSFGDIYLGTTINTGEEVAIKLECIRTKHPQLHIESKFYK-TMQGGI-GIPRI 68
            |.||:||..:|.|.:|.::|    :..:::.|.::..:....||.||....| .||... ....:
 Worm    58 GKKYKLGPVLGDGGYGTVFL----SQDDDIKIAVKTEKFSKSQLKIEIVVLKAAMQANCKHFCEL 118

  Fly    69 IWCGSEG-DYNVMVMELLGPSLEDL-FNFCSRRFSLKTVLLLADQMISRIDYIHSRDFIHRDIKP 131
            :.||::| |::.|::.|||..|..| .....|:||:.|.|.:..|.:...:.:|...|:.||:||
 Worm   119 VDCGTKGKDFDYMMITLLGKDLHKLRCELPGRKFSINTALRIGIQTLKACEELHRIGFVSRDVKP 183

  Fly   132 DNFLMGL--GKKGNLVYIIDFGLAKKFRDARSLKHIPYRENKNLTGTARYASINTHLGIEQSRRD 194
            .||..|:  .::...:::.|||||:|:.| ::.:.||.|:.....||.||.|:|.|..::..|||
 Worm   184 GNFAPGVKSNRQSRTIFMYDFGLARKYID-KNNQVIPTRKEVGWRGTTRYGSLNAHKRLDLGRRD 247

  Fly   195 DLESLGYVLMYFNLGALPWQGLKAANKRQKYERISEKKLSTSIVVLCKGFPSEFVNYLNFCRQMH 259
            ||||..|.|:....|.|||:.:.   .|...:|..|...:|.........||::...........
 Worm   248 DLESWFYGLVEMTRGTLPWRNVV---DRSSVQRAKEASHNTGRTQFLFETPSQYDKIFTIVDSYA 309

  Fly   260 FDQRPDYCHLRKL 272
            |:..|||..:.||
 Worm   310 FESAPDYKQINKL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 83/271 (31%)
C55B7.10NP_491873.4 PKc_like 60..323 CDD:389743 83/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.