DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and ttbk-6

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_498080.1 Gene:ttbk-6 / 183478 WormBaseID:WBGene00016673 Length:290 Species:Caenorhabditis elegans


Alignment Length:275 Identity:81/275 - (29%)
Similarity:123/275 - (44%) Gaps:41/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IPRIIWCGSEGDYNVMVMELLGPSLEDL--FNF-CSRRFSLKTVLLLADQMISRIDYIHSRDFIH 126
            ||.:...|.:.:::.|||.|||.:|:||  .|| .::.||..|...:..|.:..:.|:|...|||
 Worm    18 IPNLNLYGKKMNFSYMVMTLLGRNLQDLESTNFVVNKGFSRGTWSRVGIQWVYALKYVHYNGFIH 82

  Fly   127 RDIKPDNFLMGLGK---KGNLVYIIDFGLAKKFR--DARSLKHIP--YRENKNLTGTARYASINT 184
            |::...|..:|..|   :..:::|:||||.:.|.  .||..|.|.  .|.:....|:.||||.|.
 Worm    83 RNVNTQNLFLGNEKDSERAKIIHILDFGLGRPFARYHARENKWIVRIARHSAEFRGSFRYASPNV 147

  Fly   185 HLGIEQSRRDDLESLGYVLMYFNLG-ALPWQGLKAANKRQKYERISEKKLSTSIVVLCKGFPSEF 248
            ||..||.|.||:.||.||::..|.| |||||      ...:..|:.:.||:.:...:....|:..
 Worm   148 HLRKEQGRVDDVWSLPYVIIELNGGKALPWQ------TDYRRGRVEQMKLNLTPKDVMSDMPACM 206

  Fly   249 VNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDW----------------------- 290
            ...:.....:::.||||...:.|.|..:......|....|||                       
 Worm   207 DKLMPHLASLNYYQRPDDHMIFKCFWQVMENEKITPSSKFDWENEEPDMSVPPAAWENPDGRYFQ 271

  Fly   291 -NLLKFGGPRNPQAI 304
             |.|:..||..|..:
 Worm   272 SNPLEINGPPTPAEV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 72/227 (32%)
ttbk-6NP_498080.1 PKc_like 1..231 CDD:304357 71/218 (33%)
SPS1 2..287 CDD:223589 81/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.