DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and C44C10.7

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_509953.1 Gene:C44C10.7 / 183456 WormBaseID:WBGene00008088 Length:341 Species:Caenorhabditis elegans


Alignment Length:285 Identity:65/285 - (22%)
Similarity:105/285 - (36%) Gaps:67/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YRLGRKIGSGSFGDIYLGTTIN---------------TGEEVAIKLECIRTKHPQLHIE---SKF 55
            |.:...:|.|:||.:|....::               ...|.:.|||.:..:..:...|   ::|
 Worm    51 YEIISVLGGGAFGTVYSCVDVDDRLNQLAIKAMDLSTVTRENSYKLELMVLQRVETLSEVEQTRF 115

  Fly    56 YKTMQGGIGIPRIIWCGSEGDYNVMVMELLGPSLEDLF-NFCSRRFSLKTVLLLADQMISRIDYI 119
            .|.:...|         .:......||...|..::::: ...|.|||...||.:...|...:..:
 Worm   116 SKLIGNFI---------QDSSLGFFVMHKEGECVDEVWMRNKSGRFSASNVLKIVHCMAHGLRSL 171

  Fly   120 HSRDFIHRDIKPDNFLMGLGKKGNL-----VYIIDFGLAKKFRDARSLKH---IPYRENKNLTGT 176
            |...|||||....|.|..    ..|     |.|:|||:.::|.:.|.  |   .|.|:...|  .
 Worm   172 HKIGFIHRDCHAGNILFA----SRLTPTAPVKIVDFGIGRRFANRRG--HPIPSPSRDIDFL--G 228

  Fly   177 ARYASINTHLGIEQSRRDDLESLGYVLMYFNLGALPWQGLKAANKRQKYERISEKK--------- 232
            ..:.|:|.|:|.....:||.  |..||:     |:...|:.|.:.......:.:||         
 Worm   229 CEHCSVNVHVGGIPGPKDDF--LSMVLL-----AIRMSGIHAISYENSETNLCQKKSFESNPAQF 286

  Fly   233 ------LSTSIVVLCKGFPSEFVNY 251
                  |....|.:.|..|:.| ||
 Worm   287 LMRCPWLVPVSVAIIKNDPNRF-NY 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 65/285 (23%)
C44C10.7NP_509953.1 PKc_like 50..>250 CDD:389743 50/217 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.