DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and C27D8.1

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_502428.1 Gene:C27D8.1 / 178226 WormBaseID:WBGene00007777 Length:327 Species:Caenorhabditis elegans


Alignment Length:295 Identity:89/295 - (30%)
Similarity:148/295 - (50%) Gaps:14/295 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YRLGRKIGSGSFGDIYLGTTINTGEEVAIKLE--CIRTKHPQLHIESKFYKTMQGGIGIPRIIWC 71
            |.:.|.:|.|.||.:||.....:.::.|:|:|  ..:.||.:|.:|....|.:..|....:|:..
 Worm    24 YTVVRLLGEGGFGAVYLVQDNKSKKQSAMKVERKIEKRKHSKLKMEIAILKLVGSGKHFTQIVDR 88

  Fly    72 G---SEGDYNVMVMELLGPSLEDL-FNFCSRRFSLKTVLLLADQMISRIDYIHSRDFIHRDIKPD 132
            |   .|| :..:||||:|.||.|| .:...:.||..|.|.::.|.:..::.:|...|||||:||.
 Worm    89 GKKDKEG-FFFLVMELVGKSLADLKADRPDKVFSFATGLGVSCQCLEAVEELHKTGFIHRDLKPQ 152

  Fly   133 NFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYRENKNLTGTARYASINTHLGIEQSRRDDLE 197
            |:..||.:|.:.:||:|||:|:|:.:.::....| ||.....||.|:|.|..|...|...:||.|
 Worm   153 NYACGLDEKRHNIYILDFGIARKYLNTKNELKTP-RETVGFKGTVRFAPIACHRNTEMGPKDDCE 216

  Fly   198 SLGYVLMYFNL-GALPWQGLKAANK--RQKYERISEKKLSTSIVVLCKGFPSEFVNYLNFCRQMH 259
            |..|:|:...: ..|||:.|...::  ::|.|...:|:.|....:....:.|:.::|::   ...
 Worm   217 SWFYLLLDLIVPSGLPWRKLSDKHEVLKEKEECRKDKRSSLFAGLRQTDYLSKVLDYID---GRA 278

  Fly   260 FDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNLLK 294
            :..|.||..:.|.............|..:||.|.|
 Worm   279 YQDRVDYQFIYKNLAEACKVCNLDIDSPYDWELQK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 84/281 (30%)
C27D8.1NP_502428.1 PKc_like 23..290 CDD:389743 83/270 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.