DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and ttbk-2.1

DIOPT Version :10

Sequence 1:NP_524602.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_500759.1 Gene:ttbk-2.1 / 177304 WormBaseID:WBGene00018122 Length:311 Species:Caenorhabditis elegans


Alignment Length:44 Identity:14/44 - (31%)
Similarity:22/44 - (50%) Gaps:6/44 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AFNAFD--KEKTGSIPTDVVGTI----LELLGHKLSEEELDEVI 52
            :||:.|  :||...|..|:.|.|    |.|....|.:|:..::|
 Worm   277 SFNSIDEAEEKPKLIDHDINGLITQGSLSLFEKWLFDEQSHDMI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_524602.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 14/44 (32%)
ttbk-2.1NP_500759.1 STKc_TTBK 19..285 CDD:270919 3/7 (43%)

Return to query results.
Submit another query.