DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and C56C10.6

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_495333.1 Gene:C56C10.6 / 174087 WormBaseID:WBGene00016963 Length:422 Species:Caenorhabditis elegans


Alignment Length:306 Identity:92/306 - (30%)
Similarity:148/306 - (48%) Gaps:34/306 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VGNKYRLGRKIGSGSFGDIYLGTTINTGEEVAIKLE-------CIRTKHPQLHIESKFYKTMQGG 62
            ||..:::.||:|.|..|.:||...:....|.|:|.|       |:      |.:|....|.:.|.
 Worm    20 VGCSWQVIRKLGEGGCGSVYLVKNLEDETEAAMKAESNGAAGGCV------LKLEVAILKKLSGK 78

  Fly    63 IGIPRIIWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMISRIDYIHSRDFIHR 127
            ..:.:.::.....|:..::|.|||.||..:....:|:.::.:.:.:|..::..:..||...||||
 Worm    79 PHVCQFLFAARLTDFTYVIMTLLGESLNKIVKRIARQITVSSQVRIAANVLFCLKQIHDIGFIHR 143

  Fly   128 DIKPDNFLMGLGKKGN-----LVYIIDFGLAKKF------RDARSLKHIPYRENKNLTGTARYAS 181
            |:||.|  |.||.|.|     ..:::|||||::|      :.::.:...| ||.....||.||.|
 Worm   144 DLKPAN--MALGYKTNNDECRFFHVLDFGLARQFVVSQSDQPSKLMMRRP-RERSLFRGTTRYCS 205

  Fly   182 INTHLGIEQSRRDDLESLGYVLMYFNLGALPWQGLKAANKRQKYERISEKKLSTSIVVLCKGFPS 246
            |..|...||.|.|||.|:.|:|.... |.|||.  ..::||...|.   |:|.:..||| :..|.
 Worm   206 IRMHDRAEQGRVDDLWSMVYLLAELR-GPLPWS--SQSDKRVVGEM---KRLHSDEVVL-QNSPM 263

  Fly   247 EFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNL 292
            ||:....:.|.:.:..||||..:..|..::..:..|.::..|||.:
 Worm   264 EFLEIAKYLRSLTYFHRPDYHKIFMLLISVMSKGKFAWNDPFDWEM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 86/291 (30%)
C56C10.6NP_495333.1 PKc_like 24..290 CDD:389743 85/281 (30%)
CAF-1_p150 322..>407 CDD:371622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.