DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and T05A7.6

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_494824.1 Gene:T05A7.6 / 173804 WormBaseID:WBGene00020223 Length:758 Species:Caenorhabditis elegans


Alignment Length:325 Identity:89/325 - (27%)
Similarity:148/325 - (45%) Gaps:61/325 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRVG--NKYRLGRKIGSGSFGDIY--------------LGTTINTGEEVAIKLE---CIRTKHPQ 48
            |.||  :.:::...:|||.|||:|              |.|....||:..::|:   .:..|..:
 Worm   432 LGVGATDGWKVVNLLGSGGFGDVYKVHRESQASNKCYALKTESEEGEKRYLRLKVEVTVMMKTAE 496

  Fly    49 LHIESKFYKTMQ-GGIGIPRIIWCGSEGDYNVMVMELLGPSLEDLFNFCSRR------FSLKTVL 106
            ...::||...:: ...|....:.|      ..:||.|:||||||:     ||      ||..|..
 Worm   497 KKKDNKFKNFIEFVDRGKCEQLKC------KFVVMGLVGPSLEDI-----RRKYLLASFSKHTSF 550

  Fly   107 LLADQMISRIDYIHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYRENK 171
            .:|.|.::.:..:||..::||||||.|:.:||.::.:.||::|||:||.:.|...:..|..::.|
 Worm   551 NVAIQTVTALRDLHSLGYLHRDIKPANYAVGLDEREDTVYMLDFGIAKLYVDENGVHKIKRKKVK 615

  Fly   172 NLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNL----GALPWQGLKAANKRQKYERISEKK 232
            .| ||.|||.....:..||.|:||||:  ::.:.|:|    ..:||:.|  .:.|:..      |
 Worm   616 FL-GTLRYACRACMMQQEQGRKDDLET--WIYLVFDLMDEAHGMPWRAL--CDPREIL------K 669

  Fly   233 LSTSIVVLCKGFPSEFVNYLN-------FCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDW 290
            ...:.......|  :|.|.|.       :...|.:|..|||.::....:...:.:|.......||
 Worm   670 SKNTFFATFDNF--QFSNILKRLKDLVVYVDDMQYDTTPDYSYILNFLKTTANDVGAKITKKLDW 732

  Fly   291  290
             Worm   733  732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 83/308 (27%)
T05A7.6NP_494824.1 SPS1 100..>321 CDD:223589
PKc_like 116..368 CDD:304357
SPS1 439..>623 CDD:223589 58/195 (30%)
PKc_like 440..716 CDD:304357 83/299 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.