DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and TTBK2

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_005254228.1 Gene:TTBK2 / 146057 HGNCID:19141 Length:1250 Species:Homo sapiens


Alignment Length:370 Identity:110/370 - (29%)
Similarity:150/370 - (40%) Gaps:96/370 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KTMQGGIGIPRIIWCGSEGDYNVMVMELLGPSLEDLFNFCSR-RFSLKTVLLLADQMISRIDYIH 120
            |...|...:.|.|.||....:|.:||:|.|.:|.||....|| .|::.|.|.|..|::..|:.||
Human    75 KMESGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIH 139

  Fly   121 SRDFIHRDIKPDNFLMG-LGKKGNLVYIIDFGLAKKFR----DARSLKHIPYRENKNLTGTARYA 180
            |..|:||||||.||.|| ........|::|||||::|.    |.|     |.|......||.|||
Human   140 SVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVR-----PPRAVAGFRGTVRYA 199

  Fly   181 SINTHLGIEQSRRDDLESLGYVLMYFNLGALPWQGLK----AANKRQKYERISEKKLSTSIVVLC 241
            |||.|...|..|.|||.||.|:|:.|.:|.|||:.:|    ..:.:::|:.          .::.
Human   200 SINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDH----------RLML 254

  Fly   242 KGFPSEFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNLLKFGG--------- 297
            |..|.||..:|:....:.:..:|||..|..:|.|.....|......|||.  |.|.         
Human   255 KHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE--KTGNDGSLTTTTT 317

  Fly   298 ---PR-----NPQAI-----------------------QQAQDGAD------------GQAGH-- 317
               |:     .|.||                       :|..||.:            |..||  
Human   318 STTPQLHTRLTPAAIGIANATPIPGDLLRENTDEVFPDEQLSDGENGIPVGVSPDKLPGSLGHPR 382

  Fly   318 ----------DA----VAAAAAVAAAAAASSHQQQQHKVNA-ALG 347
                      ||    :......||....:||.|....:|| :||
Human   383 PQEKDVWEEMDANKNKIKLGICKAATEEENSHGQANGLLNAPSLG 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 83/234 (35%)
TTBK2XP_005254228.1 PKc_like 75..287 CDD:304357 81/226 (36%)
SPS1 78..>267 CDD:223589 76/203 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.