DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dco and Csnk1a1

DIOPT Version :9

Sequence 1:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_038952461.1 Gene:Csnk1a1 / 113927 RGDID:71098 Length:374 Species:Rattus norvegicus


Alignment Length:366 Identity:219/366 - (59%)
Similarity:260/366 - (71%) Gaps:57/366 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ELRVGNKYRLGRKIGSGSFGDIYLGTTINTGEEVAIKLECIRTKHPQLHIESKFYKTMQGGIGIP 66
            |..||.||:|.|||||||||||||...|..|||||:|||..:.:||||..|||.||.:|||:|||
  Rat    10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIP 74

  Fly    67 RIIWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMISRIDYIHSRDFIHRDIKP 131
            .|.|.|.|.||||:||:|||||||||||||||||::||||:|||||||||:|:|:::||||||||
  Rat    75 HIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKP 139

  Fly   132 DNFLMGLGK---------------------------KG-NLVYIIDFGLAKKFRDARSLKHIPYR 168
            ||||||:|:                           .| |.:::||||||||:||.|:.:|||||
  Rat   140 DNFLMGIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYR 204

  Fly   169 ENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGALPWQGLKAANKRQKYERISEKKL 233
            |:|||||||||||||.|||||||||||:|||||||||||..:|||||||||.|:||||:|||||:
  Rat   205 EDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKM 269

  Fly   234 STSIVVLCKGFPSEFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNLLKFGGP 298
            ||.:.|||||||:||..|||:||.:.|::.|||.:||:|||.||..|...|||.|||.:||    
  Rat   270 STPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLK---- 330

  Fly   299 RNPQAIQQAQDGADGQAGHDAVAAAAAVAAAAAASSHQQQQ 339
              .:|.||                       ||:||.|.||
  Rat   331 --QKAAQQ-----------------------AASSSGQGQQ 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 198/301 (66%)
Csnk1a1XP_038952461.1 STKc_CK1_alpha 16..309 CDD:271030 192/292 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X224
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.