DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd3 and CHCHD6

DIOPT Version :9

Sequence 1:NP_651838.1 Gene:Chchd3 / 43672 FlyBaseID:FBgn0010808 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001307539.1 Gene:CHCHD6 / 84303 HGNCID:28184 Length:236 Species:Homo sapiens


Alignment Length:195 Identity:49/195 - (25%)
Similarity:89/195 - (45%) Gaps:28/195 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ARQSQSREPRTVSMENPTPAGVIDISDDVVKRLKAGISQQAREHAAAAEESKPVPKPTTKAAAKP 67
            |...:|..||:.|.....|:|           :|.|:.:..:||||..::...|.|...:||.| 
Human    62 APHKESTLPRSGSSGGQQPSG-----------MKEGVKRYEQEHAAIQDKLFQVAKREREAATK- 114

  Fly    68 AASSPAASPAPKVS-SYPAAVPIYVQGGGHTISAADVQRQMNQELIKNDELWKERMAKLEENLKK 131
              .|.|:.|..:.| |:.....:.:|       |.:::.: ..||.:.|..:||::.::|....:
Human   115 --HSKASLPTGEGSISHEEQKSVRLQ-------ARELESR-EAELRRRDTFYKEQLERIERKNAE 169

  Fly   132 TNTILEKEYANAVENVHKRFVSTASSHKVPP-CQDLKSQLLACYRAHPGETLKCIEEVAQFRQCI 195
            ...:..:::..|...:.    ||....:|.| |..|::|:|.|||..|.|.|.|.:.|..:::|:
Human   170 MYKLSSEQFHEAASKME----STIKPRRVEPVCSGLQAQILHCYRDRPHEVLLCSDLVKAYQRCV 230

  Fly   196  195
            Human   231  230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd3NP_651838.1 DUF1690 <103..193 CDD:285231 23/90 (26%)
CHCH 163..195 CDD:284221 12/31 (39%)
CHCHD6NP_001307539.1 DUF737 17..190 CDD:283062 34/153 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..90 9/38 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..132 9/28 (32%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 198..208 4/9 (44%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 219..229 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4083
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5427
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002524
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.