Sequence 1: | NP_651838.1 | Gene: | Chchd3 / 43672 | FlyBaseID: | FBgn0010808 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001307539.1 | Gene: | CHCHD6 / 84303 | HGNCID: | 28184 | Length: | 236 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 49/195 - (25%) |
---|---|---|---|
Similarity: | 89/195 - (45%) | Gaps: | 28/195 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 ARQSQSREPRTVSMENPTPAGVIDISDDVVKRLKAGISQQAREHAAAAEESKPVPKPTTKAAAKP 67
Fly 68 AASSPAASPAPKVS-SYPAAVPIYVQGGGHTISAADVQRQMNQELIKNDELWKERMAKLEENLKK 131
Fly 132 TNTILEKEYANAVENVHKRFVSTASSHKVPP-CQDLKSQLLACYRAHPGETLKCIEEVAQFRQCI 195
Fly 196 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Chchd3 | NP_651838.1 | DUF1690 | <103..193 | CDD:285231 | 23/90 (26%) |
CHCH | 163..195 | CDD:284221 | 12/31 (39%) | ||
CHCHD6 | NP_001307539.1 | DUF737 | 17..190 | CDD:283062 | 34/153 (22%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 31..90 | 9/38 (24%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 106..132 | 9/28 (32%) | |||
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 | 198..208 | 4/9 (44%) | |||
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 | 219..229 | 2/9 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4083 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 56 | 1.000 | Inparanoid score | I5427 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0002524 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.820 |