DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd3 and Chchd6

DIOPT Version :9

Sequence 1:NP_651838.1 Gene:Chchd3 / 43672 FlyBaseID:FBgn0010808 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_079627.3 Gene:Chchd6 / 66098 MGIID:1913348 Length:273 Species:Mus musculus


Alignment Length:277 Identity:63/277 - (22%)
Similarity:93/277 - (33%) Gaps:84/277 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGARQSQSREPRTVSMENPTPAGV-----IDISDDVVKRLKAGISQQAREHAA---AAEESKPVP 57
            ||:  ::|.|.|.||.|......|     |.:|:.||.|:|......|.|...   ....|.|||
Mouse     1 MGS--AESAEARRVSFEMDEEERVRVLQGIRLSESVVNRMKDCSQPSAGEQLVPGFGPSSSAPVP 63

  Fly    58 K---PTTKAAAKPAASSPA-ASPAPKVSSYPAA----------VPIYVQGGGHTISAAD------ 102
            .   |.......||.::|. .:|:..|...|..          ||....|||...||..      
Mouse    64 TVPLPAISVPTVPAPTTPVPTAPSSSVRGLPGGTCKGPLTDVKVPSAESGGGLQSSAVKEDLKKF 128

  Fly   103 ------VQRQM-------------------------------------------NQELIKNDELW 118
                  ||.:|                                           ..||.:.|..:
Mouse   129 QQEQLAVQDEMVRVAKKEKEAAEKHLKASLPKKKASLTHEQQQSARLARELEDREAELSRRDTFY 193

  Fly   119 KERMAKLEENLKKTNTILEKEYANAVENVHKRFVSTASSHKVPP-CQDLKSQLLACYRAHPGETL 182
            ||:..:::|...:...:..:::..|.....    ||....:|.| |..|::|:|.|||.|..|.|
Mouse   194 KEQQGRIQEKNAELYKLSSQQFHEAASKAE----STIKPRRVEPVCSGLQAQILRCYRDHLHEVL 254

  Fly   183 KCIEEVAQFRQCIDLHR 199
            .|.:.|..::.|:...|
Mouse   255 LCSDLVKAYQHCVSTAR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd3NP_651838.1 DUF1690 <103..193 CDD:285231 26/133 (20%)
CHCH 163..195 CDD:284221 12/31 (39%)
Chchd6NP_079627.3 DUF737 17..227 CDD:283062 39/213 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..59 2/18 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..118 11/44 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..181 0/30 (0%)
CHCH 235..268 CDD:284221 13/32 (41%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 235..245 4/9 (44%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 256..266 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4083
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002524
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.