DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd3 and Chchd3

DIOPT Version :9

Sequence 1:NP_651838.1 Gene:Chchd3 / 43672 FlyBaseID:FBgn0010808 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001342596.1 Gene:Chchd3 / 66075 MGIID:1913325 Length:232 Species:Mus musculus


Alignment Length:234 Identity:60/234 - (25%)
Similarity:96/234 - (41%) Gaps:63/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GARQSQSREPRTVSMENPTPAGV----------IDISDDVVKRLKA---GISQ------------ 41
            |.|.|::...|   |:..:|:|.          ..:||:.:||..|   .:.|            
Mouse    25 GIRLSENVIDR---MKESSPSGSKSQRYSSVYGASVSDEDLKRRVAEELALEQAKKESEHQRRLK 86

  Fly    42 QA----REHAAAAEESKPVPKPTTKAAAKPAASSPAASPAPKVSSYPAAVPIYVQGGGHTISAAD 102
            ||    ||.|||.|:       .|:|..:...||.......|                | :...|
Mouse    87 QARDLERERAAANEQ-------LTRAVLRERISSEEERMKAK----------------H-LDIED 127

  Fly   103 VQRQMNQE---LIKNDELWKERMAKLEENLKKTNTILEKEYANAVENVHKRFVSTASSHKVPPCQ 164
            ..||:.::   :.|.|..:||::|:|||...:...:..:||..|.|.|..:| .....|  |.|.
Mouse   128 KARQLEEKDRVMRKQDAFYKEQLARLEERSSEFYKVTTEEYQKAAEEVEAKF-KRYEYH--PVCA 189

  Fly   165 DLKSQLLACYRAHPGETLKCIEEVAQFRQCIDLHRVQKL 203
            ||::::|.|||.:..:||.|....:|:..|:: |..|.:
Mouse   190 DLQTKILQCYRQNTQQTLSCSALASQYMHCVN-HAKQSM 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd3NP_651838.1 DUF1690 <103..193 CDD:285231 29/92 (32%)
CHCH 163..195 CDD:284221 11/31 (35%)
Chchd3NP_001342596.1 DUF737 15..180 CDD:310129 44/186 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4083
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002524
OrthoInspector 1 1.000 - - oto93319
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21588
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8821
SonicParanoid 1 1.000 - - X5081
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.900

Return to query results.
Submit another query.