Sequence 1: | NP_651838.1 | Gene: | Chchd3 / 43672 | FlyBaseID: | FBgn0010808 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012814271.1 | Gene: | chchd3 / 448247 | XenbaseID: | XB-GENE-1014488 | Length: | 251 | Species: | Xenopus tropicalis |
Alignment Length: | 266 | Identity: | 58/266 - (21%) |
---|---|---|---|
Similarity: | 94/266 - (35%) | Gaps: | 106/266 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 SREPRTVSME-----NPTPAGVIDISDDVVKRLKAGISQQAREHAAAAEESKPVPKPTTKAAAKP 67
Fly 68 AASSPAASPAPKVSSYPAAVPIYV---------------------QGGGH--------------- 96
Fly 97 --------------------TISAADVQR----------------QMNQELIKNDELWKERMAKL 125
Fly 126 EENLKKTNTILEKEYANAVENVHKRFVSTASSHKVPPCQDLKSQLLACYRAHPGETLKCIEEVAQ 190
Fly 191 FRQCID 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Chchd3 | NP_651838.1 | DUF1690 | <103..193 | CDD:285231 | 26/105 (25%) |
CHCH | 163..195 | CDD:284221 | 9/31 (29%) | ||
chchd3 | XP_012814271.1 | DUF737 | 15..199 | CDD:368377 | 41/210 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509756at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002524 | |
OrthoInspector | 1 | 1.000 | - | - | oto103560 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R8821 |
SonicParanoid | 1 | 1.000 | - | - | X5081 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 5.040 |