DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd3 and chchd3

DIOPT Version :9

Sequence 1:NP_651838.1 Gene:Chchd3 / 43672 FlyBaseID:FBgn0010808 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_012814271.1 Gene:chchd3 / 448247 XenbaseID:XB-GENE-1014488 Length:251 Species:Xenopus tropicalis


Alignment Length:266 Identity:58/266 - (21%)
Similarity:94/266 - (35%) Gaps:106/266 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SREPRTVSME-----NPTPAGVIDISDDVVKRLKAGISQQAREHAAAAEESKPVPKPTTKAAAKP 67
            |...|.||.|     |.|....|.:||:|:.|::              |.|.|||:|      :|
 Frog     4 SGSTRRVSFEADENDNITVVKGIRLSDNVINRMR--------------EPSAPVPRP------QP 48

  Fly    68 AASSPAASPAPKVSSYPAAVPIYV---------------------QGGGH--------------- 96
               ||   |.||.|:.....|.|.                     |...|               
 Frog    49 ---SP---PLPKQSTNEPVSPSYTVDEEELRRKIAHELALEQARRQSENHKRLEQEKLIVQEEIG 107

  Fly    97 --------------------TISAADVQR----------------QMNQELIKNDELWKERMAKL 125
                                ..:||:.:|                :..:||.:.||.:|:::|:|
 Frog   108 KAIERERNASSEQLTRAVLREKAAAEEERLKSKTFELRTQAKKLNEKERELKRLDEYYKDQLARL 172

  Fly   126 EENLKKTNTILEKEYANAVENVHKRFVSTASSHKVPPCQDLKSQLLACYRAHPGETLKCIEEVAQ 190
            ||...:...:..::|..|...|..|| ....:|  |.|.||::::..||:.:|.::|.|....:|
 Frog   173 EERSAQFYKVTTEQYQKAASEVEARF-KRYEAH--PVCADLQAKIFQCYQQNPQQSLSCSTLASQ 234

  Fly   191 FRQCID 196
            :..|::
 Frog   235 YLHCVN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd3NP_651838.1 DUF1690 <103..193 CDD:285231 26/105 (25%)
CHCH 163..195 CDD:284221 9/31 (29%)
chchd3XP_012814271.1 DUF737 15..199 CDD:368377 41/210 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509756at2759
OrthoFinder 1 1.000 - - FOG0002524
OrthoInspector 1 1.000 - - oto103560
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8821
SonicParanoid 1 1.000 - - X5081
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.