DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd3 and chchd3a

DIOPT Version :9

Sequence 1:NP_651838.1 Gene:Chchd3 / 43672 FlyBaseID:FBgn0010808 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_009298536.1 Gene:chchd3a / 407730 ZFINID:ZDB-GENE-030131-5005 Length:429 Species:Danio rerio


Alignment Length:230 Identity:63/230 - (27%)
Similarity:106/230 - (46%) Gaps:40/230 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QSQSREPRTVS--MENPT--PAGVIDISD---DVVKRLKAGISQQAREHAAAAEESKPVPKPTTK 62
            |:..:.|.||.  :.:||  |...:|.|:   .:.:.|:.|:.:..|:  ...|.::.:.|..::
Zfish   205 QTALQPPLTVDQPVVSPTAPPPPTVDESELRRKITEELRKGLEEDRRK--TQEELNQWLEKEKSQ 267

  Fly    63 AAAKPAASSPAASPAPKVSSYPAAVPIYVQGGGHTI---------SAAD--VQRQMNQ------- 109
            |.|| |.:...|....:||...|   :...|...||         ||.|  :|.|:.|       
Zfish   268 AHAK-AQAEAQAQVKDEVSRILA---LEKSGAEETIQKAILRERVSAEDERLQAQIYQMERKARQ 328

  Fly   110 ------ELIKNDELWKERMAKLEENLKKTNTILEKEYANAVENVHKRFVSTASSHKVPPCQDLKS 168
                  ||.|.|..::|::|||:|...:...:..:.|..|.:.|:.:|.....|   |.|.||:.
Zfish   329 LEERDKELRKQDAFYREQVAKLKERSSQFYKVTNENYHKAADEVNAKFKRYEIS---PVCTDLQG 390

  Fly   169 QLLACYRAHPGETLKCIEEVAQFRQCIDLHRVQKL 203
            |:|.|||.:.|:||.|....:|:.||::..:.:||
Zfish   391 QILKCYRENAGKTLLCSNIASQYLQCVNHAKQEKL 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd3NP_651838.1 DUF1690 <103..193 CDD:285231 31/102 (30%)
CHCH 163..195 CDD:284221 14/31 (45%)
chchd3aXP_009298536.1 DUF737 209..377 CDD:283062 42/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4083
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509756at2759
OrthoFinder 1 1.000 - - FOG0002524
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21588
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8821
SonicParanoid 1 1.000 - - X5081
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.