DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd3 and Chchd3

DIOPT Version :9

Sequence 1:NP_651838.1 Gene:Chchd3 / 43672 FlyBaseID:FBgn0010808 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_017448014.1 Gene:Chchd3 / 296966 RGDID:1310325 Length:232 Species:Rattus norvegicus


Alignment Length:227 Identity:56/227 - (24%)
Similarity:94/227 - (41%) Gaps:49/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GARQSQSREPRTVSMENPTPAGV----------IDISDDVVKRLKA-----------GISQQARE 45
            |.|.|::...|   |:..:|:|.          ..:||:.:||..|           ..:|:..:
  Rat    25 GIRLSENVIDR---MKESSPSGSKSQRYSSVYGASVSDEELKRRVAEELALEQAKMESENQRRLK 86

  Fly    46 HAAAAEESKPVP-KPTTKAAAKPAASSPAASPAPKVSSYPAAVPIYVQGGGHTISAADVQRQMNQ 109
            ||...|..|.|. :..|:|..:...||.......|                | :...|..||:.:
  Rat    87 HARDLEREKAVANEQLTRAILQERISSEENRTKVK----------------H-LDIEDKARQLEE 134

  Fly   110 E---LIKNDELWKERMAKLEENLKKTNTILEKEYANAVENVHKRFVSTASSHKVPPCQDLKSQLL 171
            :   :.|.|..:||::::|||...:...:..:||..|.|.|..:| .....|  |.|.||::::|
  Rat   135 KDRMIRKQDAFYKEQLSRLEERSSEFYKVTTEEYQKAAEEVESKF-RRYEYH--PVCADLQTKIL 196

  Fly   172 ACYRAHPGETLKCIEEVAQFRQCIDLHRVQKL 203
            .|||.:..:||.|.....|:..|:: |..|.:
  Rat   197 QCYRQNTQQTLSCSALANQYMHCVN-HAKQNM 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd3NP_651838.1 DUF1690 <103..193 CDD:285231 28/92 (30%)
CHCH 163..195 CDD:284221 11/31 (35%)
Chchd3XP_017448014.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4083
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509756at2759
OrthoFinder 1 1.000 - - FOG0002524
OrthoInspector 1 1.000 - - oto96861
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21588
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5081
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.