DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and Pp1-Y1

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster


Alignment Length:267 Identity:105/267 - (39%)
Similarity:157/267 - (58%) Gaps:13/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 IEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYV 160
            :.|:..::::.:...:|..|..::.||||:.|.||||||:.||::.||..|.|...|||.|||||
  Fly    35 VPESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLLRYFETSGHPPKKRYLMLGDYV 99

  Fly   161 DRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFDCL 225
            |||.:|:|.:..|.:.|:.|||::.|||||||...:..|:.|..||..:::..::...::.:|||
  Fly   100 DRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYDECKRRFTIRLWRMFVDCYDCL 164

  Fly   226 PLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSH 290
            |:||::|.:..|.||||||.:..|:||:.|.|..|....|.:||||||||      :.|...:..
  Fly   165 PVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCDLLWSDP------DPTAIGWEK 223

  Fly   291 NSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLDVY 355
            || ||.|:.|.......||.:.:...|.|||:..:.||..:.|.|      |||:|||.||...:
  Fly   224 NS-RGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQ------LITVFSAVNYCGEF 281

  Fly   356 NNKAAVL 362
            :|..|::
  Fly   282 DNAGAMM 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 105/267 (39%)
PP2Ac 98..369 CDD:197547 105/265 (40%)
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 105/267 (39%)
PP2Ac 36..305 CDD:197547 105/266 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.