DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and PPP6C

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001116827.1 Gene:PPP6C / 5537 HGNCID:9323 Length:342 Species:Homo sapiens


Alignment Length:317 Identity:128/317 - (40%)
Similarity:176/317 - (55%) Gaps:40/317 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PNFDALRQHFLLEGRIEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVG 145
            |.|..||  ||.|         |:......||.||.|:..|..|:||||||||||:||.:||..|
Human    52 PVFHFLR--FLKE---------RLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTG 105

  Fly   146 GPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKY 210
            |....|.|:|:||:|||||:|:|...||.:||..:|..::|||||||.|.:|:.:.|..||..||
Human   106 GQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKY 170

  Fly   211 -SESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSD 274
             :.:.:..|.:.||.|.:|||:::|.||:||||||:|.|||.|:|:.|.:|.|..|..|||:|||
Human   171 GNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSD 235

  Fly   275 PLEDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYR-MYRKNQVTG 338
            | ||......       |.||..:.|......||:..|||..|.|||:....||: |:.:     
Human   236 P-EDVDTWAI-------SPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDE----- 287

  Fly   339 FPSLITIFSAPNYLDVYNNKAAVLKYEN-NVMNIRQFNCSPH-----------PYWL 383
              .|:|::|||||.....|.|:::.::: |....:.|...|.           ||:|
Human   288 --KLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 128/317 (40%)
PP2Ac 98..369 CDD:197547 116/273 (42%)
PPP6CNP_001116827.1 MPP_PP2A_PP4_PP6 5..326 CDD:277360 124/299 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.