DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and PpY-55A

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster


Alignment Length:285 Identity:101/285 - (35%)
Similarity:161/285 - (56%) Gaps:19/285 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EGRIEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLG 157
            |..::|.:..|:|.:...:::.:..:::::||:.:||||||||.||:::|:..|.|....|||||
  Fly    23 ECTLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRIFKACGFPPKANYLFLG 87

  Fly   158 DYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAF 222
            ||||||..|:|.:..|::.|:.||....|||||||...:.:.:.|..|...:::..::.:..:.|
  Fly    88 DYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYDEIKRRHTVRLWHSFTDCF 152

  Fly   223 DCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEF 287
            :.||:|||:.::..|.||||||.:..|..|..:.|..:.|..|.||||||:|      ...|.:.
  Fly   153 NWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCDLLWAD------LNHTTKG 211

  Fly   288 FSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYL 352
            :.||. ||.|:.|......:||:..:|..:|||||..:.||..:...|      |:|:||||||.
  Fly   212 WGHND-RGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQ------LVTVFSAPNYC 269

  Fly   353 DVYNNKAAVLKYENNVMNIRQFNCS 377
            .:.||...|:....:::      ||
  Fly   270 GMMNNAGGVMSVSTDLI------CS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 101/285 (35%)
PP2Ac 98..369 CDD:197547 98/270 (36%)
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 101/285 (35%)
MPP_PP1_PPKL 8..294 CDD:277359 101/285 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438853
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.