DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and PpD5

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster


Alignment Length:296 Identity:115/296 - (38%)
Similarity:170/296 - (57%) Gaps:24/296 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GRIEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGD 158
            |.:.||....|......|...:..::::.||:.:|||:||||.||:::|:..|.|..:.||||||
  Fly    43 GNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGD 107

  Fly   159 YVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFD 223
            |||||:.|||.:..|.:.|:.||.|..|||||||...|...:.|..||..:||..::.:.::.:|
  Fly   108 YVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYD 172

  Fly   224 CLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFF 288
            |:|:||::..:..|:||||||::..||||:.|||..:.|:.|.:||||||||.|..|...:|:  
  Fly   173 CMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASND-- 235

  Fly   289 SHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLD 353
                 ||.|:.|..:....||.::....|||||:..:.||..:...|      |:||||||||.|
  Fly   236 -----RGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQ------LVTIFSAPNYCD 289

  Fly   354 VYNNKAAVLKYENNVMNIRQFNC-----SPHPYWLP 384
            :::|..|||..:..::      |     .|.|:..|
  Fly   290 IFDNCGAVLVVDAKLV------CHFVIIRPRPFSRP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 115/296 (39%)
PP2Ac 98..369 CDD:197547 110/270 (41%)
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 115/296 (39%)
MPP_superfamily 25..313 CDD:301300 112/288 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438785
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.