DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and CG11597

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster


Alignment Length:277 Identity:118/277 - (42%)
Similarity:161/277 - (58%) Gaps:21/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWS 175
            ||..|.|::.:::|..|||||||||.||:.|.|:||.....|||||||.||||..|:|..|.|.:
  Fly    43 LLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAA 107

  Fly   176 LKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKY-SESIYDACMEAFDCLPLAALLNQQFLCIH 239
            ||:.:|..:||||||||||..|..:.|.:||:.:| |.:::..|...||.|||||:::...||:|
  Fly   108 LKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVH 172

  Fly   240 GGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSA 304
            |||||::..|||:::|:|..|.|..|.:.|||||||.|..|...        |.||....|....
  Fly   173 GGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPGWAA--------SPRGHGKLFGGDV 229

  Fly   305 CCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLK------ 363
            ..||.:.|.:..|.|||:....|:| :...|:     |:||:|||||.....||||:|:      
  Fly   230 VEEFTRANGISLICRAHQLAQDGFR-WHFGQL-----LVTIWSAPNYCYRCGNKAAILRLNAAGD 288

  Fly   364 YENNVMNIRQFNCSPHP 380
            |:..|...:..:..|.|
  Fly   289 YDFKVFEAQALHSKPQP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 118/277 (43%)
PP2Ac 98..369 CDD:197547 115/264 (44%)
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 118/277 (43%)
MPP_superfamily 12..296 CDD:301300 116/266 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438868
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.