DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and PpN58A

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster


Alignment Length:291 Identity:108/291 - (37%)
Similarity:157/291 - (53%) Gaps:27/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NFDALRQHFLLEGRIEEAVAL------RIITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVK 140
            |.|.:.....|.|.|...|.:      .:.:....:|.::..::::.|||.:.||||||:.:|::
  Fly    23 NLDQIIAKLKLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLR 87

  Fly   141 LFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQE 205
            .||..|.|..:.||.||||||||..|||.:..|.:||..|||...||||||||..:..::.|..|
  Fly    88 YFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDE 152

  Fly   206 CIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDL 270
            |..:|:..::...::.::||||||::.:...|.||||||.:|::..|:.:.|..|.|..|.:||:
  Fly   153 CKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLICDI 217

  Fly   271 LWSDP-LEDFG---NEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMY 331
            ||||| |...|   ||           ||.|:.|.......||.:..|..|.|.|:..:.||..:
  Fly   218 LWSDPDLRIMGWGPNE-----------RGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFF 271

  Fly   332 RKNQVTGFPSLITIFSAPNYLDVYNNKAAVL 362
            .|.|      ||||||||||...::|..|::
  Fly   272 AKRQ------LITIFSAPNYCGEFDNAGAMM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 108/291 (37%)
PP2Ac 98..369 CDD:197547 103/275 (37%)
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 108/291 (37%)
MPP_superfamily 23..311 CDD:301300 108/291 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438873
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.