DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and Ppp2cb

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_058736.1 Gene:Ppp2cb / 24673 RGDID:3381 Length:309 Species:Rattus norvegicus


Alignment Length:280 Identity:121/280 - (43%)
Similarity:169/280 - (60%) Gaps:17/280 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LRIITEGA-ALLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYF 165
            :|.:.|.| .:|.:|.|:.:|..|:|||||:||||.||::||.:||....|.|||:||||||||:
  Rat    28 VRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYY 92

  Fly   166 SIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKY-SESIYDACMEAFDCLPLAA 229
            |:|.|..|.:||:.||..:::||||||.|.:|:.:.|..||:.|| :.:::....:.||.|||.|
  Rat    93 SVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTA 157

  Fly   230 LLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVR 294
            |::.|..|:||||||.|.|||.|:.|:|.:|.|..||||||||||| :|.|....       |.|
  Rat   158 LVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDP-DDRGGWGI-------SPR 214

  Fly   295 GCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLDVYNNKA 359
            |..|.|.......|...|.|..:.|||:....||.......|      :||||||||.....|:|
  Rat   215 GAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNV------VTIFSAPNYCYRCGNQA 273

  Fly   360 AVLKYENNV-MNIRQFNCSP 378
            |:::.::.: .:..||:.:|
  Rat   274 AIMELDDTLKYSFLQFDPAP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 121/280 (43%)
PP2Ac 98..369 CDD:197547 118/269 (44%)
Ppp2cbNP_058736.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 120/278 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.