DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and Ppp2ca

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_058735.1 Gene:Ppp2ca / 24672 RGDID:3380 Length:309 Species:Rattus norvegicus


Alignment Length:286 Identity:118/286 - (41%)
Similarity:169/286 - (59%) Gaps:16/286 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RIEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDY 159
            ::.|:....:..:...:|.:|.|:.:|..|:|||||:||||.||::||.:||....|.|||:|||
  Rat    22 QLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDY 86

  Fly   160 VDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKY-SESIYDACMEAFD 223
            |||||:|:|.|..|.:||:.|...:::||||||.|.:|:.:.|..||:.|| :.:::....:.||
  Rat    87 VDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFD 151

  Fly   224 CLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFF 288
            .|||.||::.|..|:||||||.|.|||.|:.|:|.:|.|..||||||||||| :|.|....    
  Rat   152 YLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDP-DDRGGWGI---- 211

  Fly   289 SHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLD 353
               |.||..|.|.......|...|.|..:.|||:....||.......|      :||||||||..
  Rat   212 ---SPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNV------VTIFSAPNYCY 267

  Fly   354 VYNNKAAVLKYENNV-MNIRQFNCSP 378
            ...|:||:::.::.: .:..||:.:|
  Rat   268 RCGNQAAIMELDDTLKYSFLQFDPAP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 118/286 (41%)
PP2Ac 98..369 CDD:197547 115/272 (42%)
Ppp2caNP_058735.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 117/284 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.