DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and Ppp1cc

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001257912.1 Gene:Ppp1cc / 24669 RGDID:3377 Length:337 Species:Rattus norvegicus


Alignment Length:307 Identity:113/307 - (36%)
Similarity:175/307 - (57%) Gaps:29/307 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KPNFDALRQHFLLEGR---------IEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQF 135
            |.|.|::.|. |||.|         ::|.....:..:...:...:..::::|||:.:|||||||:
  Rat     6 KLNIDSIIQR-LLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY 69

  Fly   136 FDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYF 200
            :||::|||.||.|..:.|||||||||||..|:|.:..|.:.||.||....||||||||..:...:
  Rat    70 YDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIY 134

  Fly   201 TFKQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYG 265
            .|..||..:|:..::....:.|:|||:||:::::..|.||||||::.:::.|:.:.|..:.|..|
  Rat   135 GFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQG 199

  Fly   266 PMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRM 330
            .:||||||||.:|......|:       ||.|:.|......:||.|::|..|.|||:..:.||..
  Rat   200 LLCDLLWSDPDKDVLGWGEND-------RGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEF 257

  Fly   331 YRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 377
            :.|.|      |:|:||||||...::|..|::..:..:|      ||
  Rat   258 FAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM------CS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 112/306 (37%)
PP2Ac 98..369 CDD:197547 102/270 (38%)
Ppp1ccNP_001257912.1 MPP_PP1_PPKL 8..298 CDD:277359 112/305 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.