DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and Ppp1ca

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_114074.1 Gene:Ppp1ca / 19045 MGIID:103016 Length:330 Species:Mus musculus


Alignment Length:260 Identity:104/260 - (40%)
Similarity:158/260 - (60%) Gaps:19/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 MIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPT 182
            ::::|||:.:|||||||::||::|||.||.|..:.|||||||||||..|:|.:..|.:.||.||.
Mouse    52 LLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPE 116

  Fly   183 TLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIF 247
            ...||||||||..:...:.|..||..:|:..::....:.|:|||:||:::::..|.||||||::.
Mouse   117 NFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ 181

  Fly   248 TLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKN 312
            :::.|:.:.|..:.|..|.:||||||||.:|......|:       ||.|:.|......:||.|:
Mouse   182 SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGEND-------RGVSFTFGAEVVAKFLHKH 239

  Fly   313 NLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 377
            :|..|.|||:..:.||..:.|.|      |:|:||||||...::|..|::..:..:|      ||
Mouse   240 DLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM------CS 292

  Fly   378  377
            Mouse   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 104/260 (40%)
PP2Ac 98..369 CDD:197547 101/250 (40%)
Ppp1caNP_114074.1 PTZ00480 6..308 CDD:185658 104/260 (40%)
MPP_PP1_PPKL 8..298 CDD:277359 104/260 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.