DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and Y40H4A.2

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_506609.2 Gene:Y40H4A.2 / 189799 WormBaseID:WBGene00012741 Length:333 Species:Caenorhabditis elegans


Alignment Length:291 Identity:111/291 - (38%)
Similarity:153/291 - (52%) Gaps:26/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LRIITEGAA--------LLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGD 158
            :|||:..||        |:|.:::.:    |:.:.||:||.|.||.::|.:.|.|..:.|:||||
 Worm    53 IRIISNYAAASFGSFSTLMRVDEDCL----PVHIVGDLHGHFGDLRRIFGIHGAPGISHYVFLGD 113

  Fly   159 YVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSES---IYDACME 220
            |||||...||.|:.|.:....||..|.|.|||||..:.|..:.|..||.:||.:.   .:...:.
 Worm   114 YVDRGRQGIETVMLLMAYHCLYPDHLFLCRGNHEDYNTTMTYGFFDECRMKYGKKGTLAWLHIIN 178

  Fly   221 AFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTN 285
            ||:.||||||:..:.||:|||:||.|..|:||..:.|....|:||..|||:||||      |||:
 Worm   179 AFNHLPLAALILDKVLCMHGGISPHIQKLEDIDKIQRPTFIPSYGLACDLVWSDP------EKTS 237

  Fly   286 EFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPN 350
            ......|.||.|:.|......:|.|.|.|..|||||:......|...|....|  .::|||||.|
 Worm   238 NVGWSLSARGISFSFDDITIEKFCQDNGLDLIVRAHQISSEMIRGGHKWHANG--RMVTIFSAAN 300

  Fly   351 YLDVYNNKAAVLKYENNVMN---IRQFNCSP 378
            ||.:.|:...:...|...|.   :|....||
 Worm   301 YLSMGNDSCVIRIDEQKTMQFCLLRPVKKSP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 111/291 (38%)
PP2Ac 98..369 CDD:197547 107/277 (39%)
Y40H4A.2NP_506609.2 PP2Ac 49..328 CDD:197547 109/286 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.