DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and R08A2.2

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_506632.2 Gene:R08A2.2 / 187692 WormBaseID:WBGene00011133 Length:371 Species:Caenorhabditis elegans


Alignment Length:308 Identity:103/308 - (33%)
Similarity:142/308 - (46%) Gaps:45/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 IITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIE 168
            |:.:..:.|.....|:.||.|||:.||||||...|::.|:..|.|...::||||||||||..|.|
 Worm    44 ILEKAESTLNPLPAMLQVEHPITIVGDIHGQLDALIRYFDAVGYPPKVKFLFLGDYVDRGAKSFE 108

  Fly   169 CVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFDCLPLAALLNQ 233
            ..|.|:..||.||.::.||||||||..:...:.|.:|...|....::......|:.|||.|.:.|
 Worm   109 VSLLLFCYKIRYPHSVHLLRGNHECMKMNRLYGFYEELARKRGGRMWRQYQNVFNELPLCARVGQ 173

  Fly   234 QFLCIHGGLSPEIFTLDDIKTLNRFREPPA--YGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGC 296
            :.||:|||:|....:.:..|.|.:...|..  .|...||:|:||.:|    |.|. |:.|..|..
 Worm   174 RILCMHGGISQNCNSWESFKALKKPNTPLTCDEGLQVDLMWADPTQD----KCNT-FAMNKQRAI 233

  Fly   297 SYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYR-MYRKNQVTGFPSLITIFSAPNYLDVYNNKAA 360
            |..|.......||:|..|..||||||....|:. ::.|       ..:|:||||.|.....|..|
 Worm   234 SVVFGEKGLDVFLKKLGLSLIVRAHEVSQEGFNFLFNK-------KCVTVFSAPYYCGNDTNCGA 291

  Fly   361 VLK----------------------------YENNVMNIRQFNCSPHP 380
            ::.                            .|||...:|.  .||.|
 Worm   292 IMHVSESYEISFTVLRPRMIATPENIEIVKLMENNYKGLRV--ASPDP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 103/308 (33%)
PP2Ac 98..369 CDD:197547 99/295 (34%)
R08A2.2NP_506632.2 PP2Ac 36..308 CDD:197547 96/275 (35%)
MPP_PPP_family 66..295 CDD:277316 89/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.