DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and C47A4.3

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_502650.1 Gene:C47A4.3 / 178340 WormBaseID:WBGene00008124 Length:316 Species:Caenorhabditis elegans


Alignment Length:333 Identity:117/333 - (35%)
Similarity:170/333 - (51%) Gaps:55/333 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ERMVDDVPLPPTHKLTMSEVYDDPKTGKPNFDALRQHFLLEGRIEEAVALRIITEGAALLREEKN 117
            :.::.||....||:..:.:|                       |.|...|:::.....:.:.:|.
 Worm     7 DSIIIDVLSASTHEKPLCKV-----------------------ITEERVLKLLDLALGVFKAQKP 48

  Fly   118 MIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPT 182
            |::|.|||.|||||||||.||::||..||.|.|..|||||||||||.||||.::.|.:.|:.:|.
 Worm    49 MVEVNAPIKVCGDIHGQFPDLLRLFHRGGWPPTANYLFLGDYVDRGRFSIETIVLLLAYKVKFPC 113

  Fly   183 TLSLLRGNHECRHLTEYFTFKQECIIKY-SESIYDACMEAFDCLPLAALLNQQFLCIHGGLSP-- 244
            ...||||||||..:.:.:.|.:||..:| |..:|.|..:.|:.|||..|:..:.||:||||||  
 Worm   114 NFFLLRGNHECEFVNKTYGFYEECQKRYQSVRMYAAFQDVFNWLPLTGLIATKILCMHGGLSPLM 178

  Fly   245 -EIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFS--YSACC 306
             :.||||.::.:.|..|... |.:.||||:||:.....     |.::....||.:...  .:.|.
 Worm   179 TKEFTLDTLRKIERPTEGKE-GLVADLLWADPISGLSG-----FMNNQRGAGCGFGRDSVLNLCS 237

  Fly   307 EFLQKNNLLSIVRAHEAQDAGYRMY--RKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVM 369
            ||    .|..:.|||:....||..:  ||        |:||||||:|...::|.||.:..:    
 Worm   238 EF----QLDLVCRAHQVVQDGYEFFAGRK--------LVTIFSAPHYCGQFDNCAAFMSCD---- 286

  Fly   370 NIRQFNCS 377
              .:..||
 Worm   287 --EKLQCS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 112/305 (37%)
PP2Ac 98..369 CDD:197547 109/278 (39%)
C47A4.3NP_502650.1 MPP_superfamily 5..298 CDD:301300 117/333 (35%)
PP2Ac 27..299 CDD:197547 112/290 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.