DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT7 and htr1ab

DIOPT Version :9

Sequence 1:NP_001263131.1 Gene:5-HT7 / 43669 FlyBaseID:FBgn0004573 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001139238.1 Gene:htr1ab / 797538 ZFINID:ZDB-GENE-090409-2 Length:403 Species:Danio rerio


Alignment Length:416 Identity:163/416 - (39%)
Similarity:232/416 - (55%) Gaps:52/416 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SDTPLLLE-----EFAAGEFVLP---PLT-SIFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRP 196
            :||..|.:     :.......||   ||: .|..|:::..:||.::.||..|..|:.:.|.|:..
Zfish     5 NDTSFLFQNDSDLDHQTDNVTLPVKVPLSYQISTSLLIGALILCSIFGNACVVAAIALERSLQNV 69

  Fly   197 CNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRY 261
            .|||:.|||::||.|::||:|||.||:||:||..|.:.|||::|.|:||||:|||:||||::|||
Zfish    70 ANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRY 134

  Fly   262 LAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQP-ICTVCQNFAYQIY 325
            .|||.|::|..|||.:|..|.:.:.|.....||:||:||:       :.|| .|.:..:..|.||
Zfish   135 WAITDPIDYMKKRTLKRAALLITVTWFVGFSISIPPMLIM-------KSQPKTCMISHDPWYTIY 192

  Fly   326 ATLGSFYIPLSVMLFVYYQIFRAARRIVL------EEKRAQ-----THLQQALNGTGS---PSAP 376
            :|..:|||||.:||.:|.:||:|||..:.      |:||.:     ..|.:..||..|   .||.
Zfish   193 STFCAFYIPLILMLVLYGRIFKAARFRIRKTVRKPEKKRVKCLTVSPALFKRANGELSKNWKSAV 257

  Fly   377 QAPPLGHTELASSGNGQ-RHSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHK 440
            :..|      |:..||. :|:..|. ||........|.....|.      ....|..|..:.|.|
Zfish   258 EPKP------AACVNGAIKHAEDGE-SLEIIEVHSNSKNNLPLP------NTPNSVPLFENKHEK 309

  Fly   441 ----KLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPF-ETMHVPASLSSLFLWLGYANS 500
                |.:..||:|:|...||||||..|.:|||||||.||:.|| .|..:|..|..:..||||:||
Zfish   310 NTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCPTCVMPLWLQDVINWLGYSNS 374

  Fly   501 LLNPIIYATLNRDFRKPFQEILYFRC 526
            ||||||||..|:||:..|::|:  :|
Zfish   375 LLNPIIYAYFNKDFQSAFKKII--KC 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT7NP_001263131.1 7tm_4 173..>342 CDD:304433 79/169 (47%)
7tm_1 179..507 CDD:278431 143/348 (41%)
htr1abNP_001139238.1 7tm_4 46..>208 CDD:304433 79/168 (47%)
7tm_1 52..381 CDD:278431 143/348 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002041
OrthoInspector 1 1.000 - - otm24861
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.