DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT7 and htr6

DIOPT Version :9

Sequence 1:NP_001263131.1 Gene:5-HT7 / 43669 FlyBaseID:FBgn0004573 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_009295353.1 Gene:htr6 / 568269 ZFINID:ZDB-GENE-030131-7839 Length:488 Species:Danio rerio


Alignment Length:427 Identity:139/427 - (32%)
Similarity:186/427 - (43%) Gaps:83/427 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWN 229
            ::::|.::||.|..||:|:...|...|.||...|..||||.||||.|||:|||.|:|..:...|.
Zfish    60 LAVMLSLIILVTACGNILLIALVFAHRSLRCTSNCFLVSLFLSDLMVALVVMPPAMLNVLCGTWV 124

  Fly   230 FGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACIS 294
            ..|..|.:|:.|||:||:|||||||.||:||||.|..||.|....||.|.:|.||..|..||..|
Zfish   125 LAPGFCPVWLCFDVMCCSASILNLCVISLDRYLLIISPLRYKQHMTPPRALLLVGGAWGLAALTS 189

  Fly   295 LPPLLI----LGNEHEDEEGQP-------------------------ICTVCQNFAYQIYATLGS 330
            ..|:.:    ||...|..|..|                         .|.:.....:.:.||..:
Zfish   190 FLPIKMDWHSLGRMQELTEDDPGNATHLNSFYPSSYFQLSSSGMPSTQCRLRVTLPFALVATFLT 254

  Fly   331 FYIPLSVMLFVYYQIFRAARRIVLEEKRAQTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQRH 395
            |::|.:.:.|.|.:|..|||| ...:..|.||.....:..|.||.|.:|  ||.  ...|:...|
Zfish   255 FFLPSTAICFTYCRILLAARR-QARQVEALTHPAYPQHSLGEPSRPPSP--GHA--IQDGDDYSH 314

  Fly   396 SSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEK-----KASTT 455
            ..                                ..||..:|.......:||..:     |||.|
Zfish   315 QE--------------------------------PPGLRHAPLSVNSERRLAHRQRKRALKASLT 347

  Fly   456 LGIIMSAFTVCWLPFFILALIRPFETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQE 520
            ||:::..|...||||||..:.:.. ...||.|......||||.||.:|||||....|||::....
Zfish   348 LGVLLGLFFSAWLPFFITNMAQAV-CECVPPSFFDAITWLGYCNSTMNPIIYPMFMRDFKRALAR 411

  Fly   521 ILYFRCSS----------LNTMMRENYYQDQYGEPPS 547
            :|.. |||          |:..:|.:.......||||
Zfish   412 LLPC-CSSSQAPRRPSLPLSLSLRNSGEPQLPSEPPS 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT7NP_001263131.1 7tm_4 173..>342 CDD:304433 75/197 (38%)
7tm_1 179..507 CDD:278431 120/361 (33%)
htr6XP_009295353.1 7tm_1 74..398 CDD:278431 120/361 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.