DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT7 and htr1b

DIOPT Version :9

Sequence 1:NP_001263131.1 Gene:5-HT7 / 43669 FlyBaseID:FBgn0004573 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001122181.1 Gene:htr1b / 561647 ZFINID:ZDB-GENE-081022-141 Length:380 Species:Danio rerio


Alignment Length:408 Identity:156/408 - (38%)
Similarity:224/408 - (54%) Gaps:52/408 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGNVLVCIAVCM 189
            :.:|:.| :|.||.|.:|..  .|.||         ..:.:|.||.::.|.|::.|..|...:..
Zfish    16 VLNSSTG-TNVTLTPKTDEK--QESFA---------FQVTLSSVLGLITLATILSNAFVIATISQ 68

  Fly   190 VRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLC 254
            .|||:.|.|:|:.|||::||.|::||||:.:||.|..:|..|.::||||:|.|:.|||||||:||
Zfish    69 SRKLQTPANFLIASLAVTDLLVSVLVMPICVLYTVTREWTLGQVICDIWLSSDITCCTASILHLC 133

  Fly   255 AISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQ-PICTV-C 317
            .|::|||.|||..:||..|||..|....|...|:.|..|||||..    ..:.:.|: ..|:| .
Zfish   134 VIALDRYWAITDAVEYAKKRTQARAAGMVATAWIIAISISLPPFF----WRQVKAGELTTCSVNT 194

  Fly   318 QNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEE--KRAQTHLQQALNGTGSPSAPQAPP 380
            .:..|.||:|.|:||||..:::.:|.:|:..||:.:|::  |:....|..|...|.||       
Zfish   195 DHIFYTIYSTFGAFYIPTLLLIALYGRIYVEARKRILKQSPKKPGKRLTSAHLSTNSP------- 252

  Fly   381 LGHTELASSGNGQRHSSVGNTSLTYSTCG--GLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLR 443
                           :||.:||..:  ||  .|.|..|:| |..:...|:.|..||     :|.|
Zfish   253 ---------------ASVASTSPLH--CGRQDLCSDSGSL-GSDNQIRVTVSDSLL-----EKKR 294

  Fly   444 FQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFETMHVPASLSSLFLWLGYANSLLNPIIYA 508
            ...|:|:||:.|||||:.|:.||||||||..|:.|..:......|...|.||||.|||:|||||.
Zfish   295 ISAARERKATKTLGIILGAYIVCWLPFFIYTLLIPLCSSCFSPELFDFFTWLGYVNSLINPIIYT 359

  Fly   509 TLNRDFRKPFQEILYFRC 526
            ..|.||:|.|.:::.|||
Zfish   360 MSNDDFKKAFHKVISFRC 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT7NP_001263131.1 7tm_4 173..>342 CDD:304433 73/170 (43%)
7tm_1 179..507 CDD:278431 131/333 (39%)
htr1bNP_001122181.1 7tm_1 59..358 CDD:278431 131/332 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24861
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3253
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.