DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT7 and HRH2

DIOPT Version :9

Sequence 1:NP_001263131.1 Gene:5-HT7 / 43669 FlyBaseID:FBgn0004573 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001354640.1 Gene:HRH2 / 3274 HGNCID:5183 Length:422 Species:Homo sapiens


Alignment Length:397 Identity:130/397 - (32%)
Similarity:193/397 - (48%) Gaps:91/397 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 IFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEK 227
            |.:::||.::||.||.|||:||:||.:.|:||...|..:||||::||.:.|||:|.:.:|::..|
Human    19 ITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSLAITDLLLGLLVLPFSAIYQLSCK 83

  Fly   228 WNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAAC 292
            |:||.:.|:|:.|.||:.||||||||..||:|||.|:..||.|.|..||.|:.:.:.::|:.:..
Human    84 WSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAVMDPLRYPVLVTPVRVAISLVLIWVISIT 148

  Fly   293 ISLPPL-LILGNEHEDEEGQPICTVCQ---NFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIV 353
            :|...: |...:.:|..:|....:.|:   |..|.:...|.:||:||.:|...||:||:.||   
Human   149 LSFLSIHLGWNSRNETSKGNHTTSKCKVQVNEVYGLVDGLVTFYLPLLIMCITYYRIFKVAR--- 210

  Fly   354 LEEKRAQTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGAL 418
                                  .||..:.|                           :||...| 
Human   211 ----------------------DQAKRINH---------------------------ISSWKAA- 225

  Fly   419 AGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFE-TM 482
                                       ..:|.||:.||..:|.||.:||.|:|...:.|... ..
Human   226 ---------------------------TIREHKATVTLAAVMGAFIICWFPYFTAFVYRGLRGDD 263

  Fly   483 HVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEILYFRCSSLN---TMMRENYYQ---DQ 541
            .:...|.::.||||||||.||||:||.||||||..:|::...|.::.|   |.:|.|..|   .|
Human   264 AINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQ 328

  Fly   542 YGEPPSQ 548
            ..||..|
Human   329 SREPRQQ 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT7NP_001263131.1 7tm_4 173..>342 CDD:304433 70/172 (41%)
7tm_1 179..507 CDD:278431 104/332 (31%)
HRH2NP_001354640.1 7tmA_Histamine_H2R 19..299 CDD:320179 119/359 (33%)
TM helix 1 21..45 CDD:320179 13/23 (57%)
TM helix 2 54..76 CDD:320179 11/21 (52%)
TM helix 3 92..114 CDD:320179 13/21 (62%)
TM helix 4 137..153 CDD:320179 2/15 (13%)
TM helix 5 180..203 CDD:320179 7/22 (32%)
TM helix 6 233..255 CDD:320179 9/21 (43%)
TM helix 7 267..292 CDD:320179 15/24 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..340 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.