DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT7 and Htr1f

DIOPT Version :9

Sequence 1:NP_001263131.1 Gene:5-HT7 / 43669 FlyBaseID:FBgn0004573 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_032336.1 Gene:Htr1f / 15557 MGIID:99842 Length:366 Species:Mus musculus


Alignment Length:404 Identity:153/404 - (37%)
Similarity:216/404 - (53%) Gaps:64/404 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLA 205
            ||..|..||....   :|  :.|.||:.|..:.|.|...|.||..|:.:.|||..|.|||:.|||
Mouse     7 SDQNLTSEELLNR---MP--SKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLA 66

  Fly   206 LSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEY 270
            ::|..||:||||.:::|.|.|.|..|.:|||||:|.|::|||.|||:|.||::|||.|||..:||
Mouse    67 VTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDIICCTCSILHLSAIALDRYRAITDAVEY 131

  Fly   271 GVKRTPRRMMLCVGIVWLAAACISLPPLL--ILGNEHEDEEGQPICTV-CQNFAYQIYATLGSFY 332
            ..|||||...:.:.|||:.:..||:|||.  ..|...:||     |.: ..:....||:|.|:||
Mouse   132 ARKRTPRHAGIMITIVWVISVFISMPPLFWRHQGTSRDDE-----CVIKHDHIVSTIYSTFGAFY 191

  Fly   333 IPLSVMLFVYYQIFRAARRIVLEEKRAQTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSS 397
            |||.::|.:||:|:||||.: ..:::|...:::.|||              .....||    ..|
Mouse   192 IPLVLILILYYKIYRAARTL-YHKRQASRMIKEELNG--------------QVFLESG----EKS 237

  Fly   398 VGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGST------GLLGSP-----HHKKLRFQL---AK 448
            :...|.:|.....||               ..||      ..:.||     |.|..|.|.   .:
Mouse   238 IKLVSTSYMLEKSLS---------------DPSTDFDRIHSTVKSPRSELKHEKSWRRQKISGTR 287

  Fly   449 EKKASTTLGIIMSAFTVCWLPFFILAL-IRPFETMHVPASLSSLFLWLGYANSLLNPIIYATLNR 512
            |:||:||||:|:.||.:||||||:..| :...|...:...:|:...||||.|||:||:||...|.
Mouse   288 ERKAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEEMSNFLAWLGYLNSLINPLIYTIFNE 352

  Fly   513 DFRKPFQEILYFRC 526
            ||:|.||:::  ||
Mouse   353 DFKKAFQKLV--RC 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT7NP_001263131.1 7tm_4 173..>342 CDD:304433 79/171 (46%)
7tm_1 179..507 CDD:278431 131/345 (38%)
Htr1fNP_032336.1 7tm_4 33..>155 CDD:304433 60/121 (50%)
7tm_1 41..347 CDD:278431 131/344 (38%)
Agonist binding. /evidence=ECO:0000250 99..108 4/8 (50%)
DRY motif, important for ligand-induced conformation changes. /evidence=ECO:0000250 120..122 1/1 (100%)
Agonist binding. /evidence=ECO:0000250 306..310 3/3 (100%)
NPxxY motif, important for ligand-induced conformation changes and signaling. /evidence=ECO:0000250 343..347 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42381
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3253
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.900

Return to query results.
Submit another query.