DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT7 and Hrh2

DIOPT Version :9

Sequence 1:NP_001263131.1 Gene:5-HT7 / 43669 FlyBaseID:FBgn0004573 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_036013748.1 Gene:Hrh2 / 15466 MGIID:108482 Length:421 Species:Mus musculus


Alignment Length:412 Identity:131/412 - (31%)
Similarity:191/412 - (46%) Gaps:101/412 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 IFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEK 227
            :.:|:||..:|..||.|||:||:||.:.|:||...|..:||||.:||.:.|||||.:.:|::..|
Mouse    19 VTISVVLTTLIFITVAGNVVVCLAVSLNRRLRSLTNCFIVSLAATDLLLGLLVMPFSAIYQLSFK 83

  Fly   228 WNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAAC 292
            |:||.:.|:|:.|.||:.||||||||..||:|||.|:|.||.|.|..||.|:.:.:..:|:.:..
Mouse    84 WSFGQVFCNIYTSLDVMLCTASILNLFMISLDRYCAVTDPLRYPVLVTPVRVAISLVFIWVISIT 148

  Fly   293 ISLPPLLILGNEHEDEEGQP---ICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVL 354
            :|...:.:..|......|..   .|.|..|..|.:...:.:||:||.:|...||:||:.||.   
Mouse   149 LSFLSIHLGWNSRNGTRGGNDTFKCKVQVNEVYGLVDGMVTFYLPLLIMCVTYYRIFKIARE--- 210

  Fly   355 EEKRAQTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALA 419
                                  ||..:.|                           :||...|  
Mouse   211 ----------------------QAKRINH---------------------------ISSWKAA-- 224

  Fly   420 GHGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFE-TMH 483
                                      ..:|.||:.||..:|.||.|||.|:|...:.|... ...
Mouse   225 --------------------------TIREHKATVTLAAVMGAFIVCWFPYFTAFVYRGLRGDDA 263

  Fly   484 VPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEILYFRCSSLN---------------TMM 533
            |...:..:.||||||||.||||:|||||||||..:|::.:.:.:|.|               :..
Mouse   264 VNEVVEGIVLWLGYANSALNPILYATLNRDFRMAYQQLFHCKLASHNSHKTSLRLNNSLLSRSQS 328

  Fly   534 RENYYQDQYGEPPSQRVMLGDE 555
            ||..:|::  :|...:|..|.|
Mouse   329 REGRWQEE--KPLKLQVWSGTE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT7NP_001263131.1 7tm_4 173..>342 CDD:304433 70/171 (41%)
7tm_1 179..507 CDD:278431 106/331 (32%)
Hrh2XP_036013748.1 7tmA_Histamine_H2R 19..298 CDD:320179 121/358 (34%)
TM helix 1 21..45 CDD:320179 13/23 (57%)
TM helix 2 54..76 CDD:320179 12/21 (57%)
TM helix 3 92..114 CDD:320179 13/21 (62%)
TM helix 4 137..153 CDD:320179 2/15 (13%)
TM helix 5 179..202 CDD:320179 6/22 (27%)
TM helix 6 232..254 CDD:320179 10/21 (48%)
TM helix 7 266..291 CDD:320179 15/24 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.