DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT7 and htr1fa

DIOPT Version :9

Sequence 1:NP_001263131.1 Gene:5-HT7 / 43669 FlyBaseID:FBgn0004573 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_017213382.1 Gene:htr1fa / 100005344 ZFINID:ZDB-GENE-081105-125 Length:363 Species:Danio rerio


Alignment Length:422 Identity:152/422 - (36%)
Similarity:216/422 - (51%) Gaps:66/422 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SMNSSPIAIVSYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILG 175
            |.||:        |:.|::.|.|...                |:.||..||..|::|:       
Zfish     2 SSNSA--------GMDSNHTGPSKNN----------------GDVVLLSLTLSFLAIL------- 35

  Fly   176 TVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVS 240
            |...|.||..|:.:.|||..|.|||:.|||::||.||:||||.:::|...:.|..|..||..|:|
Zfish    36 TTAMNCLVITAIIVTRKLHHPSNYLICSLAVTDLLVAILVMPFSIIYIAKDTWLIGEALCKFWLS 100

  Fly   241 FDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEH 305
            .|:.|||.|||:|.||:||||.|||..:||..|||..|..:.:.:|||.|..|||||:| |.|..
Zfish   101 VDITCCTCSILHLAAIAVDRYRAITDAVEYSRKRTSLRAAIMISVVWLLAIVISLPPIL-LRNGE 164

  Fly   306 EDEEGQPICTVCQ-NFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQTHLQQA-LN 368
            |:|     |.:.. |.|..:|:|.|:|||||.::|.:||:|:|||:  .|..:|..:.|.:: :|
Zfish   165 ENE-----CIIVHTNIASMLYSTFGAFYIPLILILILYYKIYRAAK--TLYHRRRTSCLNKSEMN 222

  Fly   369 GTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGL 433
            |...|......|.....|:.........|.....:..:.....|....:|..|            
Zfish   223 GHMLPKCSDREPTTPDTLSPPEKSMSEPSTEGDRVRITARSPKSRRERSLRRH------------ 275

  Fly   434 LGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFETMHVPAS--LSSLFLWLG 496
                     |....:||||:||||:|:.||.||||||||..:|....|:....|  :::...|||
Zfish   276 ---------RISNIREKKAATTLGLIIGAFVVCWLPFFIHEVIYNICTVSCSRSVAVTNFLTWLG 331

  Fly   497 YANSLLNPIIYATLNRDFRKPFQEILYFRCSS 528
            |.|||:||:||...|.||::.||:|:  :|.:
Zfish   332 YLNSLINPLIYTIFNEDFKRAFQKII--KCKN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT7NP_001263131.1 7tm_4 173..>342 CDD:304433 79/169 (47%)
7tm_1 179..507 CDD:278431 128/331 (39%)
htr1faXP_017213382.1 7tm_GPCRs 23..354 CDD:333717 140/366 (38%)
TM helix 1 25..49 CDD:320095 9/30 (30%)
TM helix 2 58..80 CDD:320095 14/21 (67%)
TM helix 3 96..118 CDD:320095 12/21 (57%)
TM helix 4 141..157 CDD:320095 7/15 (47%)
TM helix 5 175..198 CDD:320095 10/22 (45%)
TM helix 6 283..308 CDD:320095 18/24 (75%)
TM helix 7 321..346 CDD:320095 11/24 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.