DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and COPT5

DIOPT Version :9

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_197565.1 Gene:COPT5 / 832188 AraportID:AT5G20650 Length:146 Species:Arabidopsis thaliana


Alignment Length:196 Identity:43/196 - (21%)
Similarity:71/196 - (36%) Gaps:69/196 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 MAMFFHTGDSETILFKFWRTESAMALTLSCLLIFMVAVLYEALKFFREWLFSWDRKRLAGGRDQY 127
            |.|.|:.|...||||.||:|:|.::..|:.:..|:.:..|:.|:                     
plant     2 MHMTFYWGIKATILFDFWKTDSWLSYILTLIACFVFSAFYQYLE--------------------- 45

  Fly   128 NRPRRYREANYNYNQPTYPPRTNQQSGTQVYAYRPRSPSMPPLQPPGRSSPQAQSSLILTQHTHH 192
            ||..:::..:.:...|                            ||.|||....:.||       
plant    46 NRRIQFKSLSSSRRAP----------------------------PPPRSSSGVSAPLI------- 75

  Fly   193 HVQENTPPAGRTTKLKVFCSGMHILQTFLHVLQVLISFLLMLVFMTFNVWLCVAVLLGAGVGYYI 257
                  |.:|..:..|.       ....|..:...|.:||||..|:||..:.:|:::|...||.:
plant    76 ------PKSGTRSAAKA-------ASVLLFGVNAAIGYLLMLAAMSFNGGVFIAIVVGLTAGYAV 127

  Fly   258 F 258
            |
plant   128 F 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453
Ctr 63..258 CDD:282057 42/194 (22%)
COPT5NP_197565.1 Ctr 4..128 CDD:398012 41/192 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4266
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104136
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.