DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and COPT4

DIOPT Version :10

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_850289.1 Gene:COPT4 / 818369 AraportID:AT2G37925 Length:145 Species:Arabidopsis thaliana


Alignment Length:47 Identity:13/47 - (27%)
Similarity:29/47 - (61%) Gaps:2/47 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 QTFLHVLQVLISFLLMLVFMTFNVWLCVAVLLGAGVGYYIF--CAFR 262
            :|.::.::...|:|::|..::||..:.:|.:.|..:|:.:|  .|||
plant    94 RTAMYTVKSGFSYLVILAVVSFNGGVFLAAIFGHALGFAVFRGRAFR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 Ctr 65..258 CDD:461194 9/39 (23%)
COPT4NP_850289.1 Ctr 33..134 CDD:461194 9/39 (23%)

Return to query results.
Submit another query.