DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and slc31a2

DIOPT Version :9

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002937270.1 Gene:slc31a2 / 733902 XenbaseID:XB-GENE-5805083 Length:175 Species:Xenopus tropicalis


Alignment Length:208 Identity:54/208 - (25%)
Similarity:93/208 - (44%) Gaps:60/208 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 MAMFFHTGDSETILFKFWRTESAMALTLSCLLIFMVAVLYEALKFFREWLFSWDRKRLAGGRDQY 127
            |.|:|...::.|:||.||..::...|.|||:::.::.||||..|.       | :..|.|...| 
 Frog     1 MQMYFVFSENVTLLFDFWTVQTLAGLILSCVVVLLLTVLYEVSKV-------W-KSNLLGQALQ- 56

  Fly   128 NRPRRYREANYNYNQPTYPPRTNQQSGTQVYAYRPRSPSMPPLQPPGRSSPQAQSSLIL------ 186
                            |:|.|:..:.          :||..|       .|:|.||::.      
 Frog    57 ----------------TFPIRSTHEP----------TPSSTP-------DPEASSSIVCDPLLPS 88

  Fly   187 TQHTHHHVQ-------ENTPPAGRTTKLKVFCSGMHILQTFLHVLQVLISFLLMLVFMTFNVWLC 244
            ...:|.||:       |.|.|:..:.     ...:|...:.||:.||::.::|||..|::|..:.
 Frog    89 ASLSHQHVERLPPVIVERTQPSSNSR-----WWFLHSFLSLLHMSQVVLGYMLMLCVMSYNAAIF 148

  Fly   245 VAVLLGAGVGYYI 257
            :||:||:|:||::
 Frog   149 IAVVLGSGLGYFL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453
Ctr 63..258 CDD:282057 54/208 (26%)
slc31a2XP_002937270.1 Ctr 3..161 CDD:367839 53/204 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.140

Return to query results.
Submit another query.